BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A03f (314 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 6e-25 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.049 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 32 0.085 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 32 0.085 SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.11 SB_13696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.26 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.34 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.60 SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.79 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 0.79 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.0 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 1.0 SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 1.4 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 28 1.4 SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.8 SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) 28 1.8 SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) 28 1.8 SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) 27 2.4 SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_7056| Best HMM Match : Seryl_tRNA_N (HMM E-Value=8.1) 27 2.4 SB_3154| Best HMM Match : DUF812 (HMM E-Value=1.8) 27 2.4 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 27 3.2 SB_41024| Best HMM Match : DIL (HMM E-Value=1.3e-30) 27 3.2 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 27 4.2 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 27 4.2 SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_8482| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_56890| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 26 5.6 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_25797| Best HMM Match : Extensin_2 (HMM E-Value=0.55) 26 5.6 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 26 7.4 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.4 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.4 SB_18803| Best HMM Match : KE2 (HMM E-Value=1.5) 26 7.4 SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044) 26 7.4 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.4 SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) 25 9.8 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 25 9.8 SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_18982| Best HMM Match : M (HMM E-Value=1.1e-06) 25 9.8 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 25 9.8 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 25 9.8 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 25 9.8 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 109 bits (261), Expect = 6e-25 Identities = 66/99 (66%), Positives = 70/99 (70%), Gaps = 1/99 (1%) Frame = +2 Query: 17 MATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQND 196 MA TLEDK+IW DGEE + EEVLRM TDEIVSR RLLDNEI Sbjct: 1 MAATLEDKAIWGDGEE-MGEEVLRMSTDEIVSRARLLDNEI------------------- 40 Query: 197 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQE-EEEDGA 310 KEN+EKIKVNKTLPYLVSNVIELLDVDPQ+ EEDGA Sbjct: 41 --KENSEKIKVNKTLPYLVSNVIELLDVDPQDYAEEDGA 77 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 33.1 bits (72), Expect = 0.049 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 155 EVMRISHELQAQNDKIKENTEKIK-VNKTLPYLVSNVIELLD 277 E+ + +EL+ Q + IKEN EK+K K + L +IEL D Sbjct: 612 EITELENELEEQREIIKENEEKLKEKEKEIEKLKKKIIELSD 653 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 32.3 bits (70), Expect = 0.085 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 4/96 (4%) Frame = +2 Query: 35 DKSIWEDGEEALSEEVLRMPT--DEIVSRTRLLDNEIKIMKSE--VMRISHELQAQNDKI 202 D+ WE+ ++ L M T DE + + E K E + + ++ AQ +I Sbjct: 391 DREEWEEEQKRLDRAWYDMDTGYDETQNPFADVSEEYTKKKEEKLIKKAVKKMSAQQRQI 450 Query: 203 KENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGA 310 ++ + + N+ L S V++ LDVD EEE+ A Sbjct: 451 NKDNDMWETNRML---TSGVVQKLDVDEDFEEENEA 483 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 32.3 bits (70), Expect = 0.085 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +2 Query: 125 LDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVI---ELLDVDPQ 289 ++NE K+ ++ V ++H+L + D E E I++ PY + +V+ EL+ V P+ Sbjct: 191 VENEEKVYEALVRWVNHDLSQRRDLFPELLELIRLPLVSPYYLVDVVEKEELMTVSPR 248 >SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 748 Score = 31.9 bits (69), Expect = 0.11 Identities = 26/100 (26%), Positives = 43/100 (43%) Frame = +2 Query: 2 NHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 181 N NIT E I +DG+E E++ PT + +L DN ++ E +L Sbjct: 585 NMNITFKAHREVNRIEQDGQEVQEEQLEDNPTVPLGQEEQLEDNPTVPLEQE-----EQL 639 Query: 182 QAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEE 301 + E ++++ N T+P +E P E+EE Sbjct: 640 EDNPTVPLEQEQQLEDNPTVPLEQEEQLEDNPTVPLEQEE 679 >SB_13696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 30.7 bits (66), Expect = 0.26 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +2 Query: 26 TLEDKSIWEDGEEALSEEVLRMPTDEIVSRTR-LLDNEIKIMKSEVMRISHELQAQNDKI 202 TL+D+ W + E + + + DE++S R + I I V I ++A Sbjct: 502 TLDDEQGWVEPEPEVDAKRSCLKDDELLSMVRNIKAAHITITGEPVPEIEERMRAMTTAS 561 Query: 203 KENTEKIKVN 232 EN E +K+N Sbjct: 562 NENKELVKLN 571 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 30.3 bits (65), Expect = 0.34 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 3/87 (3%) Frame = +2 Query: 50 EDGEEALSEEVL--RMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 223 EDG E L E++ R E+ R + L+ E +++ +V + ++ + KIK+ EK+ Sbjct: 408 EDGTE-LEEKIRSQRNRITELERRVKELEKEKNLLEQQVKTMKNKSDDDDKKIKDLNEKV 466 Query: 224 KV-NKTLPYLVSNVIELLDVDPQEEEE 301 +V K L + + L D + + E+E Sbjct: 467 RVLEKQLKENDAEIQGLKDDNERLEDE 493 Score = 30.3 bits (65), Expect = 0.34 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +2 Query: 98 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLD 277 DE++ + L ++ ++ EV ++ EL+ + ++TEK+ N + ++EL Sbjct: 716 DELMKQNESLRKKVSKLEDEVRFLNDELREADSSSIKDTEKL--NAEIREFKKKIVELEK 773 Query: 278 -VDPQEEE 298 VD QEEE Sbjct: 774 LVDDQEEE 781 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 29.5 bits (63), Expect = 0.60 Identities = 12/42 (28%), Positives = 26/42 (61%) Frame = +2 Query: 98 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 223 + + S R +NEI +K+ + R+ EL++ +++ ++EKI Sbjct: 105 ESVTSELRGRENEIAELKTSIGRLESELRSLKSELQNSSEKI 146 >SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 29.1 bits (62), Expect = 0.79 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +2 Query: 59 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEK 220 + A+ E++ D VS R+ +NE+++ KSE + +Q K + E+ Sbjct: 121 QTAIQLEIVNFNDDSFVSGNRMSNNEVRVTKSESLSSPSNSYSQAFKSNNSREE 174 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 29.1 bits (62), Expect = 0.79 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +2 Query: 26 TLEDKSIWED---GEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQND 196 +LE+K +D E S E DE+V R L +E+K +K E + ++++ N Sbjct: 682 SLEEKIRLKDVVIDELKTSLETCSKERDELVESNRNLGSELKALKKENEELVSQVESLNQ 741 Query: 197 KIKE 208 K+++ Sbjct: 742 KVEQ 745 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 28.7 bits (61), Expect = 1.0 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 197 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEED 304 K+K ++ + NKT + N +E D +P+E EED Sbjct: 510 KLKSKMKRSEKNKTEELVAVNKVETDDDNPEETEED 545 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 28.7 bits (61), Expect = 1.0 Identities = 21/94 (22%), Positives = 47/94 (50%) Frame = +2 Query: 29 LEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 208 + ++ + E+ E EE +++ + + E+++M + + HE + +++IKE Sbjct: 2909 ISEEELLEEVEVQRVEEGASHDLEDVPALKESYEEEVEVM---AVGLKHEERVNDEEIKE 2965 Query: 209 NTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGA 310 EKI +++ N+I+ L+ +EE E A Sbjct: 2966 KDEKIHLDE------ENIIQDLEETFEEELEVSA 2993 >SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 1.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 128 DNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIE 268 D +K + SE ++ EL Q DKI KIK+ P + ++IE Sbjct: 104 DQPMKKLGSEFETVTGELLTQLDKISRGVRKIKLVSGDPRDIQSLIE 150 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 1.4 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = +2 Query: 38 KSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTE 217 KS+ + G+ + DE+ R L+ E+K +KSE + Q N ++ Sbjct: 224 KSLKKGGDLLFPGASYKRKLDEVAGRLDELEREVKRLKSETCQTKMTCQPCNHQLLMVGP 283 Query: 218 KIKVNKTLP 244 + + TLP Sbjct: 284 TVPIPPTLP 292 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +2 Query: 50 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKI 202 ++ E L + LR E S+ + LD+E+ + + ++ HELQ + +I Sbjct: 910 QEAEFELKLDDLRADIQERDSQIKELDSEMAEVTENIAKLQHELQGKGQEI 960 >SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 1.4 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +2 Query: 89 MPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDK-IKENTEKIKVNKTLPYLVSNVI 265 M TD+ L+ ++ M SE++R+ + A++DK ++ E I+ L+ ++ Sbjct: 76 METDQANQSVSDLEGIVQSMGSEILRLQSLVSAEDDKMLRYKVENIRRKHNYIPLIMEML 135 Query: 266 ELL 274 +LL Sbjct: 136 KLL 138 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 28.3 bits (60), Expect = 1.4 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 6/65 (9%) Frame = +2 Query: 41 SIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI--MKSEVMRISHELQAQNDKI---- 202 S W+D +L EV ++ D+ + +++D+E ++ ++S + + L D + Sbjct: 2603 SDWKDQASSLQSEVAQLKKDKAAAMHKVIDSEEQMIQLRSRLYKTEDSLVRNQDTVKLLS 2662 Query: 203 KENTE 217 KENT+ Sbjct: 2663 KENTD 2667 >SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 27.9 bits (59), Expect = 1.8 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +2 Query: 44 IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 181 I E +E ++ R+ EI+S+T +L ++IK + VMRI E+ Sbjct: 196 IIEGKKEFKLADLGRVTLKEIISKTSVLVSDIKGSRESVMRIPMEI 241 >SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) Length = 961 Score = 27.9 bits (59), Expect = 1.8 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 95 TDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVN 232 T+++V + +EI I E ++ HE++ + +I TEK+ V+ Sbjct: 376 TNKVVHEVKGKVSEISIKTDETNKVVHEVKGKVSEISIKTEKMAVD 421 >SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) Length = 768 Score = 27.9 bits (59), Expect = 1.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 206 ENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGA 310 E ++ + ++T P N +E V P+ EEEDGA Sbjct: 56 EGEKEDEASETSPRGSENSVESRSVSPKNEEEDGA 90 >SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) Length = 528 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/51 (23%), Positives = 29/51 (56%) Frame = +2 Query: 74 EEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 226 E+ + +EI+ + IK+ + + R+ HE+Q +ND + ++ +++K Sbjct: 114 EDEIAQEKEEILELKNKHSDSIKLAE-DTNRLLHEVQRKNDSLAKDMKRVK 163 >SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 27.5 bits (58), Expect = 2.4 Identities = 19/71 (26%), Positives = 32/71 (45%) Frame = +2 Query: 26 TLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIK 205 T E+K ++ ++ E + T E +T+ ++ K K + + + DK K Sbjct: 471 TKENKDKTKENKDKTKEN--KDKTKENKDKTKNNKDKTKENKDKTNENKDKTKENKDKTK 528 Query: 206 ENTEKIKVNKT 238 EN K K NKT Sbjct: 529 ENKNKTKENKT 539 >SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = +2 Query: 128 DNEIKIMKSEVMRISHELQ---AQNDKIKENTEK 220 D++I+++KSE+ + S E+Q AQ D++K +K Sbjct: 274 DDQIQMLKSELEKASTEMQGIAAQVDEVKSQADK 307 >SB_18003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = +2 Query: 50 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 208 + E+ + R P D V ++++ E+K+ K+ + H ++ D+ KE Sbjct: 309 QKSEKEVDASSERAPKDNKVRKSKIKTEELKVPKALEREVGHAKTSKKDESKE 361 >SB_7056| Best HMM Match : Seryl_tRNA_N (HMM E-Value=8.1) Length = 94 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +2 Query: 125 LDNEIK----IMKSEVMRISHELQAQNDKIKENTEKIK 226 LD E++ +M E R++ ELQAQ DK+ ++++ Sbjct: 22 LDKELEWRRDVMNKEYTRLASELQAQEDKVLNMKQQVQ 59 >SB_3154| Best HMM Match : DUF812 (HMM E-Value=1.8) Length = 815 Score = 27.5 bits (58), Expect = 2.4 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 6/86 (6%) Frame = +2 Query: 32 EDKSIWEDGEEALSEEVLRMPTD------EIVSRTRLLDNEIKIMKSEVMRISHELQAQN 193 +DK I E+ + +EV + D E+V+R RL D E+ ++ + EL N Sbjct: 618 KDKYIQEELRQLSDKEVYKETKDLTQYITELVNR-RLSDKEVYKETKDLTQYITELV--N 674 Query: 194 DKIKENTEKIKVNKTLPYLVSNVIEL 271 ++++ + ++KTL YL+ NV ++ Sbjct: 675 RRVRKLSADGFIDKTLDYLIINVRDM 700 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 27.1 bits (57), Expect = 3.2 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 59 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDK 199 +EA + +RM D+I+++ + L EI ++ M H L+ Q D+ Sbjct: 459 QEADHQSTIRMLQDQILAKEQRLVAEIAEVERSYMETEHMLREQLDE 505 >SB_41024| Best HMM Match : DIL (HMM E-Value=1.3e-30) Length = 1440 Score = 27.1 bits (57), Expect = 3.2 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +2 Query: 116 TRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEE 295 T LD E+K+ +V++ SH L D N + PY V++ +L V Sbjct: 631 THTLDKELKLHWLDVLQKSHALHKDGDYSVVNGDDQTDKIRFPYKVADEERMLQVVMGLV 690 Query: 296 EED 304 +ED Sbjct: 691 DED 693 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 26.6 bits (56), Expect = 4.2 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +2 Query: 62 EALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 226 EAL L+ ++ + L EI+ +KSEV +++ LQ Q D+++ + +K Sbjct: 217 EALRARELKANREDYQKKCESLMVEIESLKSEVQQLNSRLQNQ-DELETERKTLK 270 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 26.6 bits (56), Expect = 4.2 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 98 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLP 244 DE+ R L+ E+K +KSE + Q N ++ + + TLP Sbjct: 20 DEVAGRLDELEREVKRLKSETCQTKMTCQPCNHQLLMVGPTVPIPPTLP 68 >SB_52816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1622 Score = 26.6 bits (56), Expect = 4.2 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 187 SLQLVRDPHHFALHYFDFIVQKSGSTYDFISW 92 +L+ R + H F+F++++ Y F SW Sbjct: 325 TLKTARHDLEHSAHGFEFVIEQDSMLYGFCSW 356 >SB_8482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 26.2 bits (55), Expect = 5.6 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +2 Query: 44 IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 223 +W+ + +L +++ T+E RTRL + SE R + + K EN Sbjct: 31 MWKK-KNSLKTLIMKNETEERKKRTRLCQGNVSKRWSESERKNAGRNVEGKKFAENINYE 89 Query: 224 KVN 232 KVN Sbjct: 90 KVN 92 >SB_56890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1665 Score = 26.2 bits (55), Expect = 5.6 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +2 Query: 89 MPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENT---EKIK-VNKTLPYLVS 256 MPT V RT+L +K+ + EV + Q K++T + +K N L L++ Sbjct: 779 MPTASHVGRTKLDKERLKLCQYEVESVCTSAQELKTSTKDDTHMKDNLKAANALLQRLLN 838 Query: 257 NVIEL 271 +EL Sbjct: 839 IAVEL 843 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 26.2 bits (55), Expect = 5.6 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +2 Query: 128 DNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKT 238 + E + +++V+ +SHEL+ DK+ E+ K+ +T Sbjct: 1373 EREARQNETKVISLSHELEEYQDKLAESERLRKLAQT 1409 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 26.2 bits (55), Expect = 5.6 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +2 Query: 32 EDKSIWEDGEEALSEEV--LRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIK 205 E++ + + EE ++EV RM DE + + + EIK K+ + + + N + Sbjct: 210 EEERVKREEEEKKAKEVEEKRMGEDEEQIKLKEEEVEIKEDKTAELELEETTEKSNHAKR 269 Query: 206 ENTEKIKVNK 235 EN K++K Sbjct: 270 ENLSPSKIHK 279 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 26.2 bits (55), Expect = 5.6 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 95 TDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 223 +D + S R LD E K E R+ ELQ ++E T+K+ Sbjct: 2093 SDRMESLNRRLDTE----KEEGRRLREELQRVRTSLREQTQKV 2131 >SB_25797| Best HMM Match : Extensin_2 (HMM E-Value=0.55) Length = 910 Score = 26.2 bits (55), Expect = 5.6 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 50 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEV 160 E+G EE + P+ S RLL +++++ K EV Sbjct: 655 EEGARGEKEEAVAAPSGSNFSVLRLLGSDVQVKKPEV 691 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 25.8 bits (54), Expect = 7.4 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 92 PTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKEN 211 PT+ + R R D+EI+ E+ + EL+ Q ++EN Sbjct: 1647 PTEVVKRRGRRGDSEIQRENIELQKRIAELEIQRKSVEEN 1686 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 25.8 bits (54), Expect = 7.4 Identities = 12/53 (22%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +2 Query: 128 DNEIKIMKSEVMRISHEL-QAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVD 283 DN++ + + +++++SH+ Q Q+D+ T K + +V L D + Sbjct: 3017 DNDVGVDEKKILKLSHDFEQIQSDETAVETRKSSFQELNDLVVQEPTTLQDAN 3069 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 25.8 bits (54), Expect = 7.4 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 128 DNEIKIMKSEVMRISHELQAQNDKI-KENTEKIKVNKTLPYLVSNVIE 268 ++E K V+ + +L+A + K+NT+ I N T+ L N+IE Sbjct: 1404 ESETKDEPQIVVELEKQLEASTRALDKKNTQLIARNNTIKRLELNIIE 1451 >SB_18803| Best HMM Match : KE2 (HMM E-Value=1.5) Length = 244 Score = 25.8 bits (54), Expect = 7.4 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 101 EIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK 235 E+ S+ R L IK +S ELQ ++KE ++++V K Sbjct: 159 ELSSQCRSLYKRIKQADKNKSDLSMELQVAKGRVKEIQDELEVTK 203 >SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044) Length = 899 Score = 25.8 bits (54), Expect = 7.4 Identities = 18/74 (24%), Positives = 35/74 (47%) Frame = +2 Query: 11 ITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQ 190 I +A T+E +++ E+ E +S + +R +N IK ++ + + + Sbjct: 631 IKLAETIEQRTLIEELELKISCSLTHNAWSYF-ARALSTNNSIKALQPYINKFNPNCDFI 689 Query: 191 NDKIKENTEKIKVN 232 N +KENT K+N Sbjct: 690 NKVLKENTSIKKLN 703 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 25.8 bits (54), Expect = 7.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 252 TRYGSVLLTLIFSVFSLILSF*AC 181 T Y +VLLTL+ F+++ + AC Sbjct: 253 TEYSTVLLTLLMLAFAMVAHWLAC 276 >SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) Length = 622 Score = 25.4 bits (53), Expect = 9.8 Identities = 17/66 (25%), Positives = 31/66 (46%) Frame = +2 Query: 29 LEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 208 LE + ED E+ ++ + V +DNE + K + +I + N+K+K+ Sbjct: 472 LEQEEQLEDNPTVPLEQEEQLEDNPTVPLEEHIDNEGRKCKRQ--KICESQKTYNEKMKK 529 Query: 209 NTEKIK 226 T+K K Sbjct: 530 QTQKAK 535 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 25.4 bits (53), Expect = 9.8 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 134 EIKIMKSEVMRISHELQAQNDKIKENTEKIKV 229 EIK E L + DK K+N EKIK+ Sbjct: 256 EIKSEFDEATTTKESLSLELDKAKKNFEKIKI 287 >SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 25.4 bits (53), Expect = 9.8 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = +2 Query: 266 ELLDVDPQEEEEDG 307 +++D+ PQ+EEEDG Sbjct: 527 DIVDLQPQDEEEDG 540 >SB_18982| Best HMM Match : M (HMM E-Value=1.1e-06) Length = 825 Score = 25.4 bits (53), Expect = 9.8 Identities = 16/60 (26%), Positives = 32/60 (53%) Frame = +2 Query: 59 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKT 238 E+ L EE+ DE+ RT +D+EIK +++++ ++ L + + +I V+ T Sbjct: 107 EQYLPEEL----ADELRKRTTSVDSEIKQLENQMGQLQRTLVKGKARRESIKHRISVSST 162 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 25.4 bits (53), Expect = 9.8 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +2 Query: 32 EDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKEN 211 + K E+ E+A++E+ R+ S+ L E MKS V ++ +++ Q +K+K Sbjct: 753 DQKEATENHEQAMTEQRQRLE-----SQIEKLKEENGQMKSTVSGLASDVEMQRNKVKTL 807 Query: 212 TEK 220 E+ Sbjct: 808 REQ 810 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 25.4 bits (53), Expect = 9.8 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = +2 Query: 266 ELLDVDPQEEEEDG 307 +++D+ PQ+EEEDG Sbjct: 982 DIVDLQPQDEEEDG 995 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 25.4 bits (53), Expect = 9.8 Identities = 12/59 (20%), Positives = 35/59 (59%) Frame = +2 Query: 50 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 226 +DG+ A ++ + + T+E ++ ++ +NE++ ++ + + E + QN + ++ E +K Sbjct: 380 DDGDVAQTDGDIPIFTEEFLNYNKVRENELR----KLRKTNREFEEQNAILSKHIENMK 434 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 25.4 bits (53), Expect = 9.8 Identities = 16/60 (26%), Positives = 32/60 (53%) Frame = +2 Query: 59 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKT 238 E+ L EE+ DE+ RT +D+EIK +++++ ++ L + + +I V+ T Sbjct: 85 EQYLPEEL----ADELRKRTTSVDSEIKQLENQMGQLQRTLVKGKARRESIKHRISVSST 140 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 25.4 bits (53), Expect = 9.8 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = +2 Query: 266 ELLDVDPQEEEEDG 307 +++D+ PQ+EEEDG Sbjct: 22 DIVDLQPQDEEEDG 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,996,627 Number of Sequences: 59808 Number of extensions: 111463 Number of successful extensions: 481 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 400488992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -