BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1055.Seq (489 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32467| Best HMM Match : MFS_1 (HMM E-Value=0.41) 44 5e-05 SB_48117| Best HMM Match : LANC_like (HMM E-Value=2.3) 42 4e-04 SB_22205| Best HMM Match : DUF805 (HMM E-Value=7.7) 42 4e-04 SB_12292| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.055 SB_7041| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.055 SB_42521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_40992| Best HMM Match : DUF1531 (HMM E-Value=5.7) 32 0.29 SB_36205| Best HMM Match : ADH_zinc_N (HMM E-Value=0.00092) 30 0.89 SB_29796| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-08) 30 0.89 SB_32244| Best HMM Match : DUF1301 (HMM E-Value=5.1) 29 1.6 SB_24826| Best HMM Match : MFS_1 (HMM E-Value=1.1e-26) 29 1.6 SB_1374| Best HMM Match : PAN (HMM E-Value=0.013) 29 2.1 SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_24983| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_32467| Best HMM Match : MFS_1 (HMM E-Value=0.41) Length = 366 Score = 44.4 bits (100), Expect = 5e-05 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +2 Query: 14 QWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 +WR VFYI G +Y A FY +F SG +Q W Sbjct: 313 EWRIVFYIGGAIYAAGAVFYAVFASGEKQTW 343 >SB_48117| Best HMM Match : LANC_like (HMM E-Value=2.3) Length = 440 Score = 41.5 bits (93), Expect = 4e-04 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 2 PTQAQWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 PT+ QW+KV+YI G+YV A + G+ + Q W Sbjct: 351 PTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPW 385 >SB_22205| Best HMM Match : DUF805 (HMM E-Value=7.7) Length = 347 Score = 41.5 bits (93), Expect = 4e-04 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 2 PTQAQWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 PT+ QW+KV+YI G+YV A + G+ + Q W Sbjct: 175 PTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPW 209 >SB_12292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 34.3 bits (75), Expect = 0.055 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 8 QAQWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 Q +WR VF+I VYVV Y+ SG RQ W Sbjct: 28 QEEWRIVFWITMIVYVVAVIGYSALCSGYRQPW 60 >SB_7041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 34.3 bits (75), Expect = 0.055 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 32 YIAGGVYVVCATFYNIFGSGRRQDW 106 YI G +Y A FY +F SG +Q W Sbjct: 10 YIGGAIYAAGAVFYAVFASGEKQTW 34 >SB_42521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 32.7 bits (71), Expect = 0.17 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 2 PTQAQWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 P +A W+ VF+I+ G+YV+ A + G + W Sbjct: 1 PDRAHWQIVFFISAGLYVIGAISFVTLSKGSERRW 35 >SB_40992| Best HMM Match : DUF1531 (HMM E-Value=5.7) Length = 104 Score = 31.9 bits (69), Expect = 0.29 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 5 TQAQWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 T +WR VF+I VY+V + + SG +Q W Sbjct: 1 TAKEWRVVFWITFIVYIVGIVLFGLLVSGDKQKW 34 >SB_36205| Best HMM Match : ADH_zinc_N (HMM E-Value=0.00092) Length = 676 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 14 QWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 +WR VF+I VY+V A + F SG Q W Sbjct: 607 EWRTVFWITFFVYLVGAIVFCTFMSGDLQPW 637 >SB_29796| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-08) Length = 362 Score = 30.3 bits (65), Expect = 0.89 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -1 Query: 438 RSQQATARKYVVKITILLLFDINKNIXLILSKHTSISFYRSKM 310 R + R Y++ ITI+ + I+ + +IL K SI RSK+ Sbjct: 119 RQRSLNRRHYIIAITIIWVLAISIELPVILYKLNSIQMGRSKL 161 >SB_32244| Best HMM Match : DUF1301 (HMM E-Value=5.1) Length = 149 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 5 TQAQWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 T +WR VF+ VY++ AT + + S RQ W Sbjct: 80 TAEEWRLVFWTTLLVYIIGATVFCLLVSVDRQQW 113 >SB_24826| Best HMM Match : MFS_1 (HMM E-Value=1.1e-26) Length = 473 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 5 TQAQWRKVFYIAGGVYVVCATFYNIFGSGRRQDW 106 T +WR VF+ VY++ AT + + S RQ W Sbjct: 404 TAEEWRLVFWTTLLVYIIGATVFCLLVSVDRQQW 437 >SB_1374| Best HMM Match : PAN (HMM E-Value=0.013) Length = 498 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/18 (55%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = -2 Query: 179 LSSRSY-RLFCWQPSWHW 129 +S SY + FCW+PSW W Sbjct: 3 VSRNSYLQRFCWRPSWKW 20 >SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 296 VYKKFKRRFVIALKCIRYRRFVQPF 222 V +K K RF++A IRYRR ++ F Sbjct: 109 VLRKHKCRFILAATTIRYRRSLELF 133 >SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1845 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +3 Query: 195 ITRXQRTEDERLNKTPVXNTL*SNNKTPFEFFIYLHLFSFLSGRKRCS 338 +T+ +RTE L++ P N S + PF F Y S ++ R S Sbjct: 433 LTKKKRTEPSILDRAPRLNRSSSLDSFPFRRFAYGDFSSLMANRNEKS 480 >SB_24983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 528 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = -2 Query: 125 RRRRGCPSPVSCPNRRCCRTWHRQRKLRPRYRTLSSIALE 6 R RR P SCP RR RT R+ +L P R +S E Sbjct: 100 RGRRAVPDAASCP-RRASRT--RRGELSPTRRAVSDALAE 136 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,838,449 Number of Sequences: 59808 Number of extensions: 222101 Number of successful extensions: 577 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -