Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV1053.Seq
         (299 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000E4A177 Cluster: PREDICTED: similar to AT motif b...    31   5.1  

>UniRef50_UPI0000E4A177 Cluster: PREDICTED: similar to AT motif
            binding factor 1; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to AT motif binding factor 1 -
            Strongylocentrotus purpuratus
          Length = 3296

 Score = 31.1 bits (67), Expect = 5.1
 Identities = 14/58 (24%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = -1

Query: 233  GCWQFSELSSXYRIFIXTSVINDFQSPCIHKCS-AENDAALHEKMITLAFIQCRSRDR 63
            G  ++    S  ++ I     ND+++P IH+C     +  L  +++ + F  CR++D+
Sbjct: 2909 GLKRYRTQMSVLQLKILKHCYNDYRTPTIHECELLGQEIGLPRRVVQVWFQNCRAKDK 2966


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 213,899,108
Number of Sequences: 1657284
Number of extensions: 3066401
Number of successful extensions: 4204
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4204
length of database: 575,637,011
effective HSP length: 76
effective length of database: 449,683,427
effective search space used: 10342718821
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)