BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1050.Seq (499 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q23DT7 Cluster: Putative uncharacterized protein; n=1; ... 33 2.7 UniRef50_Q23BR6 Cluster: PX domain containing protein; n=1; Tetr... 33 2.7 >UniRef50_Q23DT7 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1680 Score = 33.5 bits (73), Expect = 2.7 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +3 Query: 87 QYWPSQNYFXNKCLNIKKMLYILYSTNYLQAQQNS*CQITLVLQFE 224 +Y YF N CLN + L NYLQ QN I+L QF+ Sbjct: 850 KYQIFMQYFENDCLNYQNFTLFLIDQNYLQQNQN---PISLQFQFQ 892 >UniRef50_Q23BR6 Cluster: PX domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: PX domain containing protein - Tetrahymena thermophila SB210 Length = 1167 Score = 33.5 bits (73), Expect = 2.7 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -3 Query: 296 FHNVLNGCTKIWHKNLLVSRSCNFLKL*YQSYL 198 FH+++N TKIW KNL + S N L L YQ+ L Sbjct: 13 FHSIINPLTKIWVKNLEANSSTN-LTLNYQNTL 44 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 400,235,464 Number of Sequences: 1657284 Number of extensions: 7185123 Number of successful extensions: 12550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12538 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29273652170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -