BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1050.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 30 0.22 SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pomb... 25 6.3 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 29.9 bits (64), Expect = 0.22 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -3 Query: 401 TSSLVGQVTFLSPHXRSEGDYGVFRFDSYSFSNDTFHNVLN 279 +SS+ G V S +S+ +Y V + + S+DT+ NVLN Sbjct: 954 SSSIPGPVLLASLKSQSKDEYSVLLYGTEVSSSDTYLNVLN 994 >SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1389 Score = 25.0 bits (52), Expect = 6.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 224 ENYKNETLTNFCAIFWYSHLKHYE 295 EN T+ + C +Y HLK YE Sbjct: 375 ENAPQSTIISECLAKYYIHLKEYE 398 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,763,669 Number of Sequences: 5004 Number of extensions: 34100 Number of successful extensions: 57 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -