BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1050.Seq (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48717| Best HMM Match : DUF963 (HMM E-Value=3.2e-05) 27 8.6 SB_30579| Best HMM Match : RVT_1 (HMM E-Value=0.00034) 27 8.6 >SB_48717| Best HMM Match : DUF963 (HMM E-Value=3.2e-05) Length = 477 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 356 RSEGDYGVFRFDSYSFSNDTFHNVLNGCTKIWHKNLLVS 240 +++G FR+DS +SN HN G T + H+ +S Sbjct: 265 KADGSKSTFRYDSPLWSNKLEHNPGAGSTGLDHQETKLS 303 >SB_30579| Best HMM Match : RVT_1 (HMM E-Value=0.00034) Length = 654 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 180 QQNS*CQITLVLQFEKITRTRH*QIFVPYFGTAI 281 +QNS C + L+LQ+ + T +F+ FG A+ Sbjct: 553 RQNSPCPVNLLLQYLVLRGTHAGPLFLDSFGNAV 586 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,279,757 Number of Sequences: 59808 Number of extensions: 226629 Number of successful extensions: 358 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 358 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -