BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1046.Seq (505 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1054 + 8330081-8330137,8330229-8330321,8330445-8330504,833... 29 2.8 >01_01_1054 + 8330081-8330137,8330229-8330321,8330445-8330504, 8330703-8330975,8331107-8331181,8331269-8331325, 8331409-8331549,8331656-8331706,8331795-8331944, 8331974-8332057,8332171-8332273,8332451-8332527, 8333469-8333704,8334000-8334078,8335123-8335218, 8335735-8335828,8336325-8336423,8336663-8337453 Length = 871 Score = 28.7 bits (61), Expect = 2.8 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 150 HYNTLNEKNK*IYINIANVHI--AKKFIHNFI-TCVTDL*PKSXVI 278 HYN +N++ IY+ + I A +IHN I C D+ P++ ++ Sbjct: 142 HYNKMNQRMPLIYVKLYMYQICRALAYIHNSIGVCHRDIKPQNLLV 187 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,403,114 Number of Sequences: 37544 Number of extensions: 61676 Number of successful extensions: 68 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -