Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV1039.Seq
         (499 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_1002 + 10171942-10172859,10173369-10173452                       28   4.8  

>08_01_1002 + 10171942-10172859,10173369-10173452
          Length = 333

 Score = 27.9 bits (59), Expect = 4.8
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 5/68 (7%)
 Frame = +3

Query: 282 RASRPKSLILMN--LDNFCRSHGQVPATHLSNVCLINF--RW*FLRLPWL-SRVXGNQGS 446
           RA +  SL L    +DN CR  G++P  + +N+ +  F     FL   WL SRV   + S
Sbjct: 242 RAPKLHSLTLWTPAVDNGCRVAGELPLLNAANISVDAFLGTEDFLDTLWLVSRVKVLKFS 301

Query: 447 IPEREPEK 470
           + +RE  K
Sbjct: 302 VRDRENRK 309


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,143,734
Number of Sequences: 37544
Number of extensions: 225159
Number of successful extensions: 444
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 438
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 444
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1047416480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)