BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1039.Seq (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 25 1.1 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 24 2.5 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 5.8 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 5.8 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 5.8 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 5.8 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 5.8 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 25.4 bits (53), Expect = 1.1 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 191 ITVVILELIHAIRTLTSDGMSVLLDQNQSTEGLASEVVNFD 313 +TVV E+ A RT T+ V+LDQN + + V + D Sbjct: 482 LTVVASEVESAGRTSTAQIRVVVLDQNDNFPEFSQPVYDID 522 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 24.2 bits (50), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 290 RGPPSIGFDLIKHSSHHWS 234 RG + G DLIKH HH S Sbjct: 286 RGRRTDGEDLIKHWQHHHS 304 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/48 (18%), Positives = 25/48 (52%) Frame = +1 Query: 46 ELPG*SCQ*LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 189 E+P + Y C + + ++ +RR + +++++P + +S+L Sbjct: 213 EVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 260 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/48 (18%), Positives = 25/48 (52%) Frame = +1 Query: 46 ELPG*SCQ*LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 189 E+P + Y C + + ++ +RR + +++++P + +S+L Sbjct: 213 EVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 260 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 372 HLKDASPVLDHAICKSY 322 HLKDASP L K++ Sbjct: 449 HLKDASPFLQERAVKNF 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 474,973 Number of Sequences: 2352 Number of extensions: 9107 Number of successful extensions: 62 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -