BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1037.Seq (349 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 25 0.22 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 25 0.29 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 24 0.39 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 24 0.39 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 25.0 bits (52), Expect = 0.22 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 147 ILAGDYDHLPEVAFYMV--GPIEEVVAKADT 61 I +GDY+H+P + Y G I E++ K +T Sbjct: 291 IKSGDYNHVPMIFGYTTREGMIVEMMRKTET 321 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 24.6 bits (51), Expect = 0.29 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 168 TIKGFSKILAGDYDHLPEVAFYMV--GPIEEVVAKADT 61 T + + I +GDY+H+P + Y G I E++ K +T Sbjct: 286 TDEPIATIKSGDYNHVPMIFGYTTREGMIVEMMRKNET 323 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 24.2 bits (50), Expect = 0.39 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 147 ILAGDYDHLPEVAFYMV--GPIEEVVAKADT 61 I +GDY+H+P + Y G I E++ K +T Sbjct: 291 IKSGDYNHVPMIFGYTTREGMIVEMMRKNET 321 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 24.2 bits (50), Expect = 0.39 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 147 ILAGDYDHLPEVAFYMV--GPIEEVVAKADT 61 I +GDY+H+P + Y G I E++ K +T Sbjct: 293 IKSGDYNHVPMIFGYTTREGMIVEMMRKNET 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,357 Number of Sequences: 336 Number of extensions: 1118 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -