BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1031.Seq (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 25 1.4 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 4.4 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 4.4 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.0 bits (52), Expect = 1.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 162 FA*PINFASLWFRNEARELNRTW 94 F PIN W+R R++N+ W Sbjct: 43 FVLPINNKDKWYRTCNRQINQQW 65 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 4.4 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 365 RHQR-QQPIKRHGQENKRFE*YFTNTQYQATTRFLCEN 255 R++R +QP KR E KR F+N Q Q EN Sbjct: 483 RYRRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNEN 520 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 4.4 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -3 Query: 365 RHQR-QQPIKRHGQENKRFE*YFTNTQYQATTRFLCEN 255 R++R +QP KR E KR F+N Q Q EN Sbjct: 483 RYRRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNEN 520 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 495,848 Number of Sequences: 2352 Number of extensions: 9106 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -