BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1019.Seq (588 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 5.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 6.8 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 21 9.0 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = -2 Query: 422 AALKNENKNSINKSLNTKANLQNCSIEK 339 + +++ +KN L+ K+++QN S+ K Sbjct: 564 STIEDADKNQCRHYLDAKSSVQNYSLAK 591 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/42 (23%), Positives = 22/42 (52%) Frame = -2 Query: 440 KNTKSDAALKNENKNSINKSLNTKANLQNCSIEKDNFTSEPK 315 KN+++ + K ++N + N+Q CS ++++S K Sbjct: 627 KNSENSIMQRASMKENLNVYPEFQENVQLCSEISESYSSNNK 668 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -1 Query: 177 VIDKISNDSHENKCDVLNKIFDD 109 V+D+ N + +N D++ + DD Sbjct: 72 VVDENGNFNEKNTRDIVQAVLDD 94 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,305 Number of Sequences: 438 Number of extensions: 2034 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -