BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1018.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31444| Best HMM Match : No HMM Matches (HMM E-Value=.) 125 3e-29 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 32 0.27 SB_56015| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_2361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_50474| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 30 1.4 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 30 1.4 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 30 1.4 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 30 1.4 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 30 1.4 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 1.4 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 30 1.4 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 1.4 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 1.9 SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 29 2.5 SB_31415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_16484| Best HMM Match : MSG (HMM E-Value=0.24) 29 2.5 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) 29 3.3 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 29 3.3 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_21731| Best HMM Match : Ribosomal_L13e (HMM E-Value=7.2) 28 4.4 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) 27 7.6 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_54380| Best HMM Match : LEM (HMM E-Value=0.5) 27 7.6 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 27 7.6 SB_50053| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 27 7.6 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) 27 7.6 SB_38866| Best HMM Match : HHH (HMM E-Value=0.00018) 27 7.6 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_29853| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) 27 7.6 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 27 7.6 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_21862| Best HMM Match : ABC_membrane_2 (HMM E-Value=1) 27 7.6 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_15196| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 27 7.6 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 27 7.6 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_4964| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) 27 7.6 SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) 27 7.6 SB_53858| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_53755| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_49262| Best HMM Match : Virus_P-coat (HMM E-Value=1.8) 27 7.6 SB_48920| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_48851| Best HMM Match : zf-C2H2 (HMM E-Value=3.2e-13) 27 7.6 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 27 7.6 SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 27 7.6 SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_40034| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) 27 7.6 SB_34485| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_34258| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 27 7.6 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_30561| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_29458| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_28685| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_28611| Best HMM Match : MAM (HMM E-Value=4.4e-22) 27 7.6 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_26020| Best HMM Match : UCR_TM (HMM E-Value=6.4) 27 7.6 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 27 7.6 SB_21460| Best HMM Match : GAS2 (HMM E-Value=0.0008) 27 7.6 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 27 7.6 SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) 27 7.6 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) 27 7.6 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 27 7.6 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 27 7.6 SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) 27 7.6 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 27 7.6 SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 27 7.6 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_279| Best HMM Match : rve (HMM E-Value=3.2) 27 7.6 >SB_31444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 125 bits (301), Expect = 3e-29 Identities = 57/76 (75%), Positives = 68/76 (89%) Frame = -2 Query: 484 MKFNKQVTSSXRKNRKRHFSAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRG 305 MK N +V+SS RK+RK HFSAPS +RR LMS+PLSKELRQK+NV+S+P+RKDDEVQV RG Sbjct: 1 MKRNSEVSSSRRKSRKAHFSAPSSVRRKLMSAPLSKELRQKYNVRSIPVRKDDEVQVTRG 60 Query: 304 HYKGQQVGKVMQVYRK 257 H+K QQVGKV+QVYRK Sbjct: 61 HFKSQQVGKVIQVYRK 76 Score = 81.0 bits (191), Expect = 6e-16 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = -1 Query: 257 KFVVYIERIQREKANGATAYVGIHPSKCVIVKLKMNKDRKAILDRRAKGRLAALGK 90 K+V++I+RIQREKANGAT VGIHPSK IVKLK++KDRK ILDR+ + +LA GK Sbjct: 77 KWVIHIDRIQREKANGATVSVGIHPSKVEIVKLKIDKDRKKILDRKNRSKLAEKGK 132 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 32.3 bits (70), Expect = 0.27 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = +1 Query: 388 ERTSTLALYVKEH*NASSCFS---FXRKSPAC*TSFCRXGRXIXIKAYRXRRPRGG 546 ++ + L Y K H + SC S RK+ +C FC +AYR RRPRGG Sbjct: 492 KKANGLKTYRKIHTHFISCSSREALKRKASSC---FCHGCGTYSYQAYRYRRPRGG 544 >SB_56015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.36 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 484 MKFNKQVTSSXRKNRKRHFSAPSHIRRVLMSSPLSKELRQKFNVKSMP--IRK 332 MK + Q+ RK+ K H P HIR+ S + K +R+ N + P IRK Sbjct: 1 MKTHSQIQKHTRKS-KTHSQIPKHIRKSKTHSQIQKHIRKSKNTLANPKHIRK 52 >SB_2361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 Query: 477 NFILSXRPXNSYQSLSXPSTSRGG 548 N + RP N+ SLS PSTSRGG Sbjct: 202 NTLHDKRPFNTLSSLSIPSTSRGG 225 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 31.1 bits (67), Expect = 0.62 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -2 Query: 547 PPLEVDGIDKL*XEFXGRC-DRMKFNKQVTSSXRKNRKR 434 PPLEVDGIDKL + G ++ K K+ S+ K R Sbjct: 21 PPLEVDGIDKLDEDLQGASKEQQKHPKEKLSNSEKQLPR 59 >SB_50474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 547 PPLEVDGIDKL*XEFXGRCD 488 PPLEVDGIDKL E CD Sbjct: 21 PPLEVDGIDKLDEEVVVTCD 40 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 8 PPLEVDGIDKLDIEF 22 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 26 PPLEVDGIDKLDIEF 40 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 51 PPLEVDGIDKLDIEF 65 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 23 PPLEVDGIDKLDIEF 37 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 8 PPLEVDGIDKLDIEF 22 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 22 PPLEVDGIDKLDIEF 36 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 26 PPLEVDGIDKLDIEF 40 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 10 PPLEVDGIDKLDIEF 24 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 22 PPLEVDGIDKLDIEF 36 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 59 PPLEVDGIDKLDIEF 73 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLEVDGIDKL EF Sbjct: 21 PPLEVDGIDKLDIEF 35 >SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4248 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = -3 Query: 213 WCNSICRHSPFKVCDCQVEDE*RPQSNPRSQSKGQTGCTWQRQG*IHRGNCHSHG 49 W N IC ++C C+V DE N + ++ G TW R +R + G Sbjct: 525 WHNRICMR--VEICGCKVCDEPLGMENSKIKANDIEGHTWTRNREPYRARLNYRG 577 >SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 547 PPLEVDGIDKL*XEFXG 497 PPLEVDGIDKL ++ G Sbjct: 21 PPLEVDGIDKLDVQYTG 37 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 29.1 bits (62), Expect = 2.5 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = -2 Query: 547 PPLEVDGIDKL*XEFXGR---CDRMKFNKQVTSSXRKNRKRHFSAPSHIRRVLMSSPLSK 377 PPLEVDGIDKL G+ + + ++ +R+R + RR+ + Sbjct: 21 PPLEVDGIDKLDSGESGQNGTQQKKRKRRRKRMLTGVSRQRRAANERERRRIQGVNRAFV 80 Query: 376 ELRQKFNVKSMPIRKDDEVQV 314 EL+ V M I K D ++V Sbjct: 81 ELKNSLPVSHMDISKIDILRV 101 >SB_31415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 29.1 bits (62), Expect = 2.5 Identities = 25/96 (26%), Positives = 39/96 (40%) Frame = +2 Query: 116 LLCDRGLLCGLYSSST*QSHTLKGECRHMLLHHWPFLFESSQCIQQIFTIHLHHFANLLT 295 LLC L GL++ T Q K + L HH LF + QQIF + H T Sbjct: 103 LLCGDDLYLGLFTGPTVQLFGAKFVTGNTLFHHQEKLFNLLR--QQIFKLENLHEGRAWT 160 Query: 296 FVVSTYNLNFIVFANRHGFYIEFLS*FLRQGRGHQH 403 V ++ I+ ++ + Y+ + + H H Sbjct: 161 LSVMHRHIMTIILSSIN-MYVIIIIIIINSHISHYH 195 >SB_16484| Best HMM Match : MSG (HMM E-Value=0.24) Length = 661 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 39 LRGLHGCGSFLGVFTLVFAKCSQS 110 L GLH CG + VFAKC Q+ Sbjct: 72 LVGLHPCGDLVPTMLKVFAKCDQA 95 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -2 Query: 547 PPLEVDGIDKL-*XEFXGRCDRMKFNKQVTSSXRKNRKRH 431 PPLEVDGIDKL F +M K + +K R +H Sbjct: 21 PPLEVDGIDKLDDTSFALYLSKMTRGKVLERLDKKLRNKH 60 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -2 Query: 547 PPLEVDGIDKL*XEFXGR---CDRMKFNKQVTSSXRKNRKRH 431 PPLEVDGIDKL D + F+K + + K +RH Sbjct: 21 PPLEVDGIDKLDHTVQKANVLDDNLDFSKTIKTICIKTIRRH 62 >SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) Length = 199 Score = 28.7 bits (61), Expect = 3.3 Identities = 24/82 (29%), Positives = 34/82 (41%), Gaps = 2/82 (2%) Frame = -2 Query: 547 PPLEVDGIDKL*XEFXGRC-DRMKFNKQVTSSXRKNRKRHFSAP-SHIRRVLMSSPLSKE 374 PPLEVDGIDKL + + K Q + R +RK S P ++ S + Sbjct: 8 PPLEVDGIDKLDAARPRQASSKTKPQDQDKQAARPSRKTKTSKPKDQEKQAARPSKPQDQ 67 Query: 373 LRQKFNVKSMPIRKDDEVQVVR 308 +Q S K ++Q R Sbjct: 68 DKQAVRQASRKTSKPQDMQTAR 89 >SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) Length = 198 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 458 GSHLLVELHSVAXAAEFXSKLIDXVDLEGG 547 GS L V ++ ++ E KLID VDLEGG Sbjct: 113 GSTLNVHINLLSAPPEGNIKLIDTVDLEGG 142 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 547 PPLEVDGIDKL*XEF 503 PPLE+DGIDKL EF Sbjct: 8 PPLELDGIDKLDIEF 22 >SB_21731| Best HMM Match : Ribosomal_L13e (HMM E-Value=7.2) Length = 606 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -2 Query: 478 FNKQVTSSXRKNRKRHFSAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDD 326 F+ S +K+ +R+F +HI + + +S SK+ ++ K + DD Sbjct: 124 FSTSQASRPKKSNRRYFPTSNHIAKAISASRYSKDDQESLKRKVEEWQTDD 174 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 497 AAEFXSKLIDXVDLEGG 547 +A+F KLID VDLEGG Sbjct: 39 SADFWIKLIDTVDLEGG 55 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +2 Query: 467 LLVELHSVAXAAEFXS--KLIDXVDLEGG 547 LL +LHS A + + KLID VDLEGG Sbjct: 203 LLRKLHSSTQATFYYANIKLIDTVDLEGG 231 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 482 HSVAXAAEFXSKLIDXVDLEGG 547 H A F KLID VDLEGG Sbjct: 72 HYPANTVSFIIKLIDTVDLEGG 93 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) Length = 1065 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 80 PPLEVDGIDKL 90 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_54380| Best HMM Match : LEM (HMM E-Value=0.5) Length = 731 Score = 27.5 bits (58), Expect = 7.6 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 2/93 (2%) Frame = -2 Query: 481 KFNKQVTSSXRKNRKRHFSAPSHIRRVLMSS-PLSKELRQKFNVKSMP-IRKDDEVQVVR 308 K N TS+ + RH + ++ + M + L E Q + P +KDD++ V+R Sbjct: 335 KINFAATSTSTFSAGRHRPVGNPLKSIHMKALNLQLEKLQAERARGEPHTQKDDQI-VIR 393 Query: 307 GHYKGQQVGKVMQVYRKNLLYTLRGFKEKRPMV 209 +Y G Q G + R ++L ++ +P V Sbjct: 394 HYYSGIQRGDEIINVRDSVLLKAGTRRKDQPFV 426 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) Length = 129 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_50053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 959 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/56 (26%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Frame = -2 Query: 418 SHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQ--VVRGHYKGQQVGKVMQVYRK 257 + ++++ + + K LR+ K+MP R+D+++Q V YK ++VG+ + R+ Sbjct: 139 NEVKQLGNGNNMEKILREFIKKKNMPKREDEKLQGNVSGRDYKNKKVGQKSEEQRE 194 >SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) Length = 143 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) Length = 679 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_38866| Best HMM Match : HHH (HMM E-Value=0.00018) Length = 120 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_29853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 275 DAGVS*KFVVYIERIQREKANGATAYVGI 189 D VS KF+V+I R+Q EK +G+ Sbjct: 67 DFNVSMKFIVFIARVQTEKFRSLACCLGL 95 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) Length = 151 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 3438 PPLEVDGIDKL 3448 >SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_21862| Best HMM Match : ABC_membrane_2 (HMM E-Value=1) Length = 140 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 61 PPLEVDGIDKL 71 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 473 VELHSVAXAAEFXSKLIDXVDLEGG 547 +EL EF KLID VDLEGG Sbjct: 58 LELVDPPGLQEFDIKLIDTVDLEGG 82 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_15196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_4964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) Length = 598 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 92 PPLEVDGIDKL 102 >SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) Length = 93 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_53858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_53755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_49262| Best HMM Match : Virus_P-coat (HMM E-Value=1.8) Length = 586 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 425 CSFTYKASVDVLSPV*GTKTKIQCKIHAYSQR 330 CS K ++ L+ + GT KI+ K HA+S++ Sbjct: 72 CSCKTKTELNALNELLGTDEKIEKKSHAWSEK 103 >SB_48920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_48851| Best HMM Match : zf-C2H2 (HMM E-Value=3.2e-13) Length = 169 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_40034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 81 TLVFAKCSQSALCSAIEDCFAVFI 152 T+ + C + + CS I DCF VFI Sbjct: 221 TMPLSFCQKFSSCSVIIDCFEVFI 244 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) Length = 197 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_34485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_34258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) Length = 200 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_30561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_29458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_28685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_28611| Best HMM Match : MAM (HMM E-Value=4.4e-22) Length = 229 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_26020| Best HMM Match : UCR_TM (HMM E-Value=6.4) Length = 122 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) Length = 999 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 810 PPLEVDGIDKL 820 >SB_21460| Best HMM Match : GAS2 (HMM E-Value=0.0008) Length = 123 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) Length = 212 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) Length = 828 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 122 CDRGLLCGLYSSST*QSHTLKGE-CRHMLLHHWPFLF 229 C G + + ST + L+G+ CR M+L HWP F Sbjct: 325 CKNGKVPVVSGGSTYDTWPLQGDFCRTMMLLHWPNWF 361 >SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) Length = 168 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 27.5 bits (58), Expect = 7.6 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 377 LRQGRGHQHSPYM*RSTEMPLPVFPS*GSHLLVELHSVAXAAEFXS--KLIDXVDLEGG 547 LR+ R + P RS ++ P P+ +H L +A F KLID VDLEGG Sbjct: 9 LREVRRSGNQPERQRSIQIRQP--PAWPTHRLNLARRIANPIRFPFNIKLIDTVDLEGG 65 >SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 22 PPLEVDGIDKL 32 >SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) Length = 137 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 409 PPLEVDGIDKL 419 >SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) Length = 163 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 >SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2324 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 1886 PPLEVDGIDKL 1896 >SB_829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 21 PPLEVDGIDKL 31 >SB_279| Best HMM Match : rve (HMM E-Value=3.2) Length = 188 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 547 PPLEVDGIDKL 515 PPLEVDGIDKL Sbjct: 8 PPLEVDGIDKL 18 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,865,870 Number of Sequences: 59808 Number of extensions: 324080 Number of successful extensions: 1459 Number of sequences better than 10.0: 185 Number of HSP's better than 10.0 without gapping: 1382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1459 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -