BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1015.Seq (459 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51994-7|AAO21384.1| 429|Caenorhabditis elegans Elongation fact... 81 3e-16 U51994-6|AAA96068.1| 463|Caenorhabditis elegans Elongation fact... 81 3e-16 U40935-2|AAA81688.1| 463|Caenorhabditis elegans Elongation fact... 81 3e-16 Z92835-1|CAB07395.2| 532|Caenorhabditis elegans Hypothetical pr... 41 5e-04 AL033514-38|CAA22111.2| 341|Caenorhabditis elegans Hypothetical... 29 1.6 AF036700-1|AAB88364.1| 258|Caenorhabditis elegans Hypothetical ... 27 6.6 AC006708-23|AAF60414.1| 975|Caenorhabditis elegans Paz/piwi dom... 27 6.6 AF047657-1|AAK18951.1| 328|Caenorhabditis elegans Serpentine re... 27 8.7 AC024791-32|AAY55887.1| 212|Caenorhabditis elegans Hypothetical... 27 8.7 >U51994-7|AAO21384.1| 429|Caenorhabditis elegans Elongation factor protein 4, isoformd protein. Length = 429 Score = 81.4 bits (192), Expect = 3e-16 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -2 Query: 419 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAGGGKVT 264 IV L+P+KPLCVESF ++ PLGRFAVRDMRQTVAVGVIK+V + GKVT Sbjct: 367 IVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVEKSDGSSGKVT 418 >U51994-6|AAA96068.1| 463|Caenorhabditis elegans Elongation factor protein 4, isoforma protein. Length = 463 Score = 81.4 bits (192), Expect = 3e-16 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -2 Query: 419 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAGGGKVT 264 IV L+P+KPLCVESF ++ PLGRFAVRDMRQTVAVGVIK+V + GKVT Sbjct: 401 IVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVEKSDGSSGKVT 452 >U40935-2|AAA81688.1| 463|Caenorhabditis elegans Elongation factor protein 3 protein. Length = 463 Score = 81.4 bits (192), Expect = 3e-16 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -2 Query: 419 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAGGGKVT 264 IV L+P+KPLCVESF ++ PLGRFAVRDMRQTVAVGVIK+V + GKVT Sbjct: 401 IVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVEKSDGSSGKVT 452 >Z92835-1|CAB07395.2| 532|Caenorhabditis elegans Hypothetical protein H19N07.1 protein. Length = 532 Score = 40.7 bits (91), Expect = 5e-04 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -2 Query: 419 IVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAV 297 I+ L +P +E F+E+P LGRF +RD +T+A+G V+K V Sbjct: 490 IMRLESPEPFVLEPFKEYPYLGRFTLRDEGKTIAIGKVLKVV 531 >AL033514-38|CAA22111.2| 341|Caenorhabditis elegans Hypothetical protein Y75B8A.33 protein. Length = 341 Score = 29.1 bits (62), Expect = 1.6 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -3 Query: 157 KRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFC 50 KR NS++F I+ C + F Y++ + +C Sbjct: 262 KRDVNSYVFVIWGVVCQILFFLTTYRIAELVVRIYC 297 >AF036700-1|AAB88364.1| 258|Caenorhabditis elegans Hypothetical protein M04G7.1 protein. Length = 258 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 295 LTALMTP-TATVCLMSRTAKRPRGGNSWKDSTHRG 396 + AL P T ++CL + K P GN+ D T RG Sbjct: 174 MMALYCPRTCSLCLWAAATKIPNCGNTLPDCTTRG 208 >AC006708-23|AAF60414.1| 975|Caenorhabditis elegans Paz/piwi domain-containing protein2 protein. Length = 975 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 202 HTTAILHSPKGVSKEKRATNSFLFYIFYKACNVTLFYNL 86 H TA L S K V+ K+ F+ + ++ C+ LF+ L Sbjct: 107 HITAELSSKKEVTFTKKGKEDFIVHDRHEKCSAILFHAL 145 >AF047657-1|AAK18951.1| 328|Caenorhabditis elegans Serpentine receptor, class j protein54 protein. Length = 328 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 228 LELLTAQFFIQLRYFIHRKVFRRKKGLQTHSFSIFFT 118 + L+ A + + L +FI+R + L TH F + T Sbjct: 96 ISLVAASYAVLLTHFIYRYLVIHNSSLATHKFHWYLT 132 >AC024791-32|AAY55887.1| 212|Caenorhabditis elegans Hypothetical protein Y47G6A.31 protein. Length = 212 Score = 26.6 bits (56), Expect = 8.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 97 FYNLYKVIHNISETFCYDC 41 F +L K++ N TFCY C Sbjct: 44 FQHLPKLLENCGHTFCYSC 62 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,737,163 Number of Sequences: 27780 Number of extensions: 179168 Number of successful extensions: 435 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 820565746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -