BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1013.Seq (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 3.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.2 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 386 EPTSTVQVSSHALSALAPGALITPTPFLPAEST 288 EPTS A +A +PG L +P S+ Sbjct: 901 EPTSAAFAQGFATAASSPGLLERASPAFSGTSS 933 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.6 bits (41), Expect = 8.2 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +1 Query: 277 DNIDVDSAGKKGVGVINAPGANA 345 DN+ ++G +GV +++A A + Sbjct: 710 DNVMCRTSGPRGVAIVSASTARS 732 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -1 Query: 374 TVQVSSHALSALAPGALITPTPFLPAESTSM 282 T +++ S ++ P LPA STS+ Sbjct: 836 TTTINTPTTSVISMSGTTVPITSLPASSTSI 866 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,384 Number of Sequences: 438 Number of extensions: 1415 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -