BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1011.Seq (409 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit... 32 0.039 SPCC1183.02 |||glutathione S-transferase |Schizosaccharomyces po... 31 0.069 SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Sch... 27 1.1 SPBC28F2.09 |||transcription factor TFIIA complex large subunit ... 26 2.0 SPCC1183.03c |||frataxin homolog|Schizosaccharomyces pombe|chr 3... 25 3.4 SPAC11G7.06c |mug132||S. pombe specific UPF0300 family protein 3... 25 3.4 SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce... 25 4.5 SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pomb... 25 6.0 SPAC20G4.04c |hus1||checkpoint clamp complex protein Hus1|Schizo... 24 7.9 SPBC1652.02 |aap1|SPBC16A3.20c|APC amino acid transporter|Schizo... 24 7.9 SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyce... 24 7.9 >SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 409 Score = 31.9 bits (69), Expect = 0.039 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +3 Query: 126 NKSEDFLKKFPAGKVPAFESADGKVLLTESNAIAYYVAN 242 N D KFP K+P F DG L+E+ AIA+Y+A+ Sbjct: 38 NFPADLAAKFPLQKMPVFVGKDG-FPLSETLAIAFYLAS 75 >SPCC1183.02 |||glutathione S-transferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 220 Score = 31.1 bits (67), Expect = 0.069 Identities = 25/76 (32%), Positives = 32/76 (42%) Frame = +3 Query: 6 MAAGVLYTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFES 185 M G LY++ N R L A+ V + + S D KFP K+P F Sbjct: 1 MFLGTLYSFKTNTRTVCLLELAKLLDLQVDLVETYPH---KFSADLAAKFPLQKLPVFIG 57 Query: 186 ADGKVLLTESNAIAYY 233 ADG L+E AI Y Sbjct: 58 ADG-FELSEVIAIVKY 72 >SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Schizosaccharomyces pombe|chr 1|||Manual Length = 738 Score = 27.1 bits (57), Expect = 1.1 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +3 Query: 33 PENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTE 212 P F++ KA + QY+ +FG +K ++F K+ ++ F S + +L+ Sbjct: 553 PNYFKSLKAELNRQYAAAVNSGTRPLLFGSLSKYQNFTKEKLESEIVRF-SFEHSILINT 611 Query: 213 SN 218 SN Sbjct: 612 SN 613 >SPBC28F2.09 |||transcription factor TFIIA complex large subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 369 Score = 26.2 bits (55), Expect = 2.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 202 STFPSALSNAGTFPAGNFFKKSSDL 128 +TFP A + GTFP G F S L Sbjct: 52 ATFPWAQAPVGTFPIGQLFDPVSGL 76 >SPCC1183.03c |||frataxin homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 158 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 Query: 186 ADGKVLLTESNAIAYYVANESLRVEIWLPKPVSGXGH 296 A+G + L Y + + +IWL PVSG H Sbjct: 79 ANGVITLMLGEKGTYVINKQPPAHQIWLSSPVSGPKH 115 >SPAC11G7.06c |mug132||S. pombe specific UPF0300 family protein 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 25.4 bits (53), Expect = 3.4 Identities = 8/27 (29%), Positives = 19/27 (70%) Frame = -2 Query: 246 FHWQRSKRWHCFQLGAPFHRHFRMQAL 166 FH ++ +HC+++G P ++++ +AL Sbjct: 363 FHHDYTE-YHCYRIGKPLYQNYEEEAL 388 >SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.0 bits (52), Expect = 4.5 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +3 Query: 9 AAGVLYTYPENFRAYKALIAAQYSG-TDVKVAPNFV-FGE 122 A G +YT E+FRA K+L S T V+ FV FGE Sbjct: 329 ALGSVYTIQESFRAEKSLTRRHLSEFTHVEFELPFVNFGE 368 >SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1073 Score = 24.6 bits (51), Expect = 6.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 207 TESNAIAYYVANESLRVEIWLPK 275 +ES I YY N E+WLP+ Sbjct: 722 SESRIIVYYSNNTLYLSELWLPQ 744 >SPAC20G4.04c |hus1||checkpoint clamp complex protein Hus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 24.2 bits (50), Expect = 7.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 70 HNIPGLM*K*HRISYLARPTSPKTS*RSFLPE 165 HNIP + +S + PT+P+ FLP+ Sbjct: 125 HNIPVRVLSQSYVSVIKEPTAPEPDCHIFLPQ 156 >SPBC1652.02 |aap1|SPBC16A3.20c|APC amino acid transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 24.2 bits (50), Expect = 7.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 93 KVAPNFVFGETNKSEDFLK 149 K+ P+ F E + SEDFLK Sbjct: 52 KLRPDNEFAEVHNSEDFLK 70 >SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 2104 Score = 24.2 bits (50), Expect = 7.9 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = -2 Query: 210 QLGAPFHRHFRMQALFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYKRGSFPD 31 Q G+P R +M+AL R + S+ + RNSVL + + ++ K G + Sbjct: 1418 QPGSPSKRSGKMEALIRNFDQNSSIPDPFIVNQRNSVLQTEFEKINLKLKEATKSGILDN 1477 Query: 30 K 28 K Sbjct: 1478 K 1478 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,613,312 Number of Sequences: 5004 Number of extensions: 30213 Number of successful extensions: 89 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 140222766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -