BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1011.Seq (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 87 7e-18 SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) 32 0.21 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 29 1.9 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_53789| Best HMM Match : ResIII (HMM E-Value=0.044) 27 4.5 SB_54545| Best HMM Match : TIP49 (HMM E-Value=4.3) 27 5.9 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 86.6 bits (205), Expect = 7e-18 Identities = 42/77 (54%), Positives = 52/77 (67%) Frame = +3 Query: 6 MAAGVLYTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFES 185 MAAG LYTYP++FRA K LIAA+YSGT ++V P F FG+ N + +FLKKFP GKVPAFE+ Sbjct: 1 MAAGKLYTYPDSFRAQKILIAAEYSGTKIEV-PAFTFGKDNHTAEFLKKFPLGKVPAFET 59 Query: 186 ADGKVLLTESNAIAYYV 236 + YV Sbjct: 60 KTANACTRAMPLLTTYV 76 >SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) Length = 505 Score = 31.9 bits (69), Expect = 0.21 Identities = 19/76 (25%), Positives = 33/76 (43%) Frame = +3 Query: 39 NFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESN 218 N +K + Q + K+ P V GE N + +KK +P GK + + + Sbjct: 105 NIGKFKMVWIDQIDESTKKLKPKMVAGEDNGFVNAIKKVSLEDIPEGNGPSGKAIREKRS 164 Query: 219 AIAYYVANESLRVEIW 266 I + N+SL + +W Sbjct: 165 IIVNDIENDSL-MNLW 179 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 168 LFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYK 49 +FR + + + S ++ N V +SHQSR IV T+ K Sbjct: 102 VFRSKQQAPNKAVGRSDEVTNEVAVSHQSRRIVESETVRK 141 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 28.7 bits (61), Expect = 1.9 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 7/76 (9%) Frame = +3 Query: 99 APNFVFGET---NKSEDFLKKFPAGKVPAFE---SADGKVL-LTESNAIAYYVANESLRV 257 +PN +F + +E +L F +G + E SA+G++ L +A ++++ R Sbjct: 1798 SPNKMFNTAAPQSSNEVWLTSFCSGHSLSVELAASAEGQLNGLVSQAGVASLLSSQGFRE 1857 Query: 258 EIWLPKPVSGXGHXGL 305 +W P+PVSG L Sbjct: 1858 GLWKPEPVSGEAFSSL 1873 >SB_53789| Best HMM Match : ResIII (HMM E-Value=0.044) Length = 942 Score = 27.5 bits (58), Expect = 4.5 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 228 KRWHCFQ-LGAPFHRHFRMQALFRQETSSRSL-RTCWSRQIR 109 K W+ + LGA H H M+A R + RSL R C+ +IR Sbjct: 487 KVWNSKETLGAQPHAHIDMRAAMRGQCLRRSLGRHCFGTEIR 528 >SB_54545| Best HMM Match : TIP49 (HMM E-Value=4.3) Length = 516 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 72 QYSGTDVKVAPNFVFGETNKSEDFLK-KFPAGKVP 173 QY+ T +++ +FVF +T+ LK KF ++P Sbjct: 49 QYTKTGIRLCQSFVFNKTSSENVLLKTKFWESRIP 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,442,551 Number of Sequences: 59808 Number of extensions: 243098 Number of successful extensions: 491 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -