BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1011.Seq (409 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 34 0.002 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 28 0.15 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 3.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 22 7.5 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 33.9 bits (74), Expect = 0.002 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 2/104 (1%) Frame = +3 Query: 60 LIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESNAIAYYVA 239 L+ A++ ++ + V + +FLK P +P ADG V++ ES+AI Y+A Sbjct: 19 LLFAKWLKLELNLIELDVLKRDHYKPEFLKLNPQHYIPTLVDADGDVVVWESSAILIYLA 78 Query: 240 NE--SLRVEIWLPKPVSGXGHXGLTANYXLLPALGSXLPWYHAI 365 + + PK ++ Y + + S +YH I Sbjct: 79 ERYGAADDDTLYPKDIALRAKVNQRLFYDIGTLMRSVTTYYHPI 122 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 27.9 bits (59), Expect = 0.15 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 123 TNKSEDFLKKFPAGKVPAFESADGK--VLLTESNAIAYYV 236 + K E +L+K P GKVPA E GK V L ES ++ Y+ Sbjct: 55 SEKPEWYLEKNPLGKVPALE-IPGKEGVTLYESLVLSDYI 93 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 3.2 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -1 Query: 199 TFPSALSNAGTFPAGNFFKKSSDLLVSPNTKFGATFTSVPEYCAAINAL 53 T P+ ++ P+ S DLL+ T T PEY ++ L Sbjct: 291 TLPNIVNFIAQLPSDELRLSSIDLLLQSLTAENGTLVQDPEYVYRLSQL 339 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.2 bits (45), Expect = 7.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 131 VRRLLEEVSCRKSACIRKCRWKGAPN*KQC 220 VR+ E + AC+RKC P +C Sbjct: 262 VRKCPEHLLKDNGACVRKCPKGKMPQNSEC 291 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 418,495 Number of Sequences: 2352 Number of extensions: 7385 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -