BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1011.Seq (409 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.0 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 2.3 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 4.1 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 1.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 21 LYTYPENFRAYKALIAAQYSGTDVKVA 101 L+ PE+F A ALI+ Q G + VA Sbjct: 1616 LFRKPEHFVASYALISNQCEGDSLNVA 1642 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 2.3 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +2 Query: 107 FRIWRDQQVRRLLEEVSCRKSACIRKCRWKG 199 F IWRD ++ E + +A + W G Sbjct: 32 FEIWRDSLPTKMRELNATACAALYERVEWSG 62 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 4.1 Identities = 10/45 (22%), Positives = 17/45 (37%) Frame = +2 Query: 215 QCHRLLRCQ*KSPXGDLATQARVWQXASWSDSELLXASCXRVXPT 349 +C +C+ +P G + + D LL C + PT Sbjct: 61 KCEIYAKCEFLNPGGSVKDRIAYRMIQDAEDKGLLKPGCTIIEPT 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,843 Number of Sequences: 438 Number of extensions: 2317 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -