BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1007.Seq (548 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6Z1L6 Cluster: Putative uncharacterized protein OSJNBa... 35 1.1 UniRef50_Q4XXI3 Cluster: Putative uncharacterized protein; n=1; ... 35 1.4 >UniRef50_Q6Z1L6 Cluster: Putative uncharacterized protein OSJNBa0091M20.22; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein OSJNBa0091M20.22 - Oryza sativa subsp. japonica (Rice) Length = 162 Score = 35.1 bits (77), Expect = 1.1 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +1 Query: 472 SVSRHYRPCSGHRGRPSQPSWPA 540 S S+H+R C+ GRPS PSWP+ Sbjct: 69 SSSQHHRRCTASVGRPSAPSWPS 91 >UniRef50_Q4XXI3 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 79 Score = 34.7 bits (76), Expect = 1.4 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = -2 Query: 211 HYISIHLKKNFFMYSISFI*KSFVNNLSYIFIYVSSYF*SFDVYINIYLFINM 53 +YI ++K+ FFM ++ K +N L Y++I+ S F I Y+ I+M Sbjct: 18 NYIQCNIKRTFFMTVHKYLSKKIINTLIYVYIFFSLKL-GFIYNIYTYIIISM 69 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 448,651,607 Number of Sequences: 1657284 Number of extensions: 7338231 Number of successful extensions: 14375 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14312 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 35822246242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -