BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1006.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 7.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.1 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 9.4 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.0 bits (42), Expect = 7.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 120 EQNGSLHVRHYL*HFRVAYPINSMTSK*HLT 212 E+N H+R+ L +V P+ TS+ H T Sbjct: 57 EKNRRAHLRNCLEKLKVLVPLGPETSR-HTT 86 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 7.1 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = -1 Query: 328 RHPYLADFKGHFFAHRDGSPSSTLQSTIFTTFAGNTELCVK 206 R+P+ +F H F R + S T + +T F + K Sbjct: 422 RNPWFVEFWEHHFQCRYPNASVTPYNKNYTKFCSTEKRLTK 462 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 73 KTILHYNGIIFYT 111 K ILHY G + +T Sbjct: 124 KAILHYTGKVLWT 136 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,718 Number of Sequences: 438 Number of extensions: 2696 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -