BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1005.Seq (563 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0358 - 4692079-4692567 34 0.090 01_06_1365 - 36690267-36692222 31 0.63 >04_01_0358 - 4692079-4692567 Length = 162 Score = 33.9 bits (74), Expect = 0.090 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +3 Query: 168 LKEKALRYVENVSNSRELNLIDGVSLIGQAPLDQPGPSSLYPTSPEP 308 +KE AL+Y N+ E N+ S+I PLD P P L + P P Sbjct: 26 IKELALKYKINIQEQIEENIKIPKSIISLLPLDPPPPLVLSSSQPAP 72 >01_06_1365 - 36690267-36692222 Length = 651 Score = 31.1 bits (67), Expect = 0.63 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 551 IRPLTAGKGNDSEKRG*GTGSSVAGVPVWAGVASTSSSY-RDLL 423 + P+ +G G +RG G G G+P AG TS S+ R LL Sbjct: 605 LTPMRSGGGGGGARRGGGGGGGGGGLPAKAGRQLTSQSFARSLL 648 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,215,640 Number of Sequences: 37544 Number of extensions: 318887 Number of successful extensions: 1043 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1041 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -