BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1004.Seq (554 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.6 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 4.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 6.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 6.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.3 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 8.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 8.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 8.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.4 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 377 ASPSPSRVGQTPPVGAGPGTVDTPREAIKPHSSTSP 484 +SP+ + + Q P GTV P++ P SS P Sbjct: 1257 SSPATALMLQHAPPAYSCGTVSVPQQQQLPPSSPQP 1292 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 4.8 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -2 Query: 523 GGEHLCHWF 497 GG+H HWF Sbjct: 19 GGKHTVHWF 27 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 12 PSVPPAPLFARPN 50 P +PPA F PN Sbjct: 1499 PGIPPAATFLSPN 1511 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 12 PSVPPAPLFARPN 50 P +PPA F PN Sbjct: 1495 PGIPPAATFLSPN 1507 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 205 QQQYQLETDHHQYLNHF 255 QQQ Q + Q LNH+ Sbjct: 1454 QQQQQQQQQQQQQLNHY 1470 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 97 GNFPPRPIMVRP 108 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 97 GNFPPRPIMVRP 108 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 97 GNFPPRPIMVRP 108 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 97 GNFPPRPIMVRP 108 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 97 GNFPPRPIMVRP 108 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 97 GNFPPRPIMVRP 108 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 97 GNFPPRPIMVRP 108 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 346 GNFPPRPIMVRP 357 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 346 GNFPPRPIMVRP 357 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 346 GNFPPRPIMVRP 357 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 346 GNFPPRPIMVRP 357 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 346 GNFPPRPIMVRP 357 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 346 GNFPPRPIMVRP 357 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 345 GNFPPRPIMVRP 356 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 330 GNFPPRPIMVRP 341 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 294 GNWPVRPVQGRP 329 GN+P RP+ RP Sbjct: 346 GNFPPRPIMVRP 357 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,503 Number of Sequences: 438 Number of extensions: 3191 Number of successful extensions: 23 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -