SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV1004.Seq
         (554 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   1.6  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     22   4.8  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   6.3  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   6.3  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   6.3  
DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex det...    21   8.4  
DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex det...    21   8.4  
DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex det...    21   8.4  
DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex det...    21   8.4  
DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex det...    21   8.4  
DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex det...    21   8.4  
DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex det...    21   8.4  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          21   8.4  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          21   8.4  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          21   8.4  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          21   8.4  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          21   8.4  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          21   8.4  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          21   8.4  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    21   8.4  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    21   8.4  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +2

Query: 377  ASPSPSRVGQTPPVGAGPGTVDTPREAIKPHSSTSP 484
            +SP+ + + Q  P     GTV  P++   P SS  P
Sbjct: 1257 SSPATALMLQHAPPAYSCGTVSVPQQQQLPPSSPQP 1292


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -2

Query: 523 GGEHLCHWF 497
           GG+H  HWF
Sbjct: 19  GGKHTVHWF 27


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +3

Query: 12   PSVPPAPLFARPN 50
            P +PPA  F  PN
Sbjct: 1499 PGIPPAATFLSPN 1511


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +3

Query: 12   PSVPPAPLFARPN 50
            P +PPA  F  PN
Sbjct: 1495 PGIPPAATFLSPN 1507


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +1

Query: 205  QQQYQLETDHHQYLNHF 255
            QQQ Q +    Q LNH+
Sbjct: 1454 QQQQQQQQQQQQQLNHY 1470


>DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 97  GNFPPRPIMVRP 108


>DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 97  GNFPPRPIMVRP 108


>DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 97  GNFPPRPIMVRP 108


>DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 97  GNFPPRPIMVRP 108


>DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 97  GNFPPRPIMVRP 108


>DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 97  GNFPPRPIMVRP 108


>DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 97  GNFPPRPIMVRP 108


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 346 GNFPPRPIMVRP 357


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 346 GNFPPRPIMVRP 357


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 346 GNFPPRPIMVRP 357


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 346 GNFPPRPIMVRP 357


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 346 GNFPPRPIMVRP 357


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 346 GNFPPRPIMVRP 357


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 345 GNFPPRPIMVRP 356


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 330 GNFPPRPIMVRP 341


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +3

Query: 294 GNWPVRPVQGRP 329
           GN+P RP+  RP
Sbjct: 346 GNFPPRPIMVRP 357


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 140,503
Number of Sequences: 438
Number of extensions: 3191
Number of successful extensions: 23
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15949830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -