BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1002.Seq (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36159| Best HMM Match : Peptidase_M28 (HMM E-Value=0) 28 6.1 SB_27982| Best HMM Match : Cu2_monooxygen (HMM E-Value=2.9e-07) 28 6.1 >SB_36159| Best HMM Match : Peptidase_M28 (HMM E-Value=0) Length = 771 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -3 Query: 354 VFQTGSEHPH-VNVNREAKHYRNYKXIGSQFLSNGL 250 VFQTG EHP + E Y + + +G + +GL Sbjct: 367 VFQTGPEHPWLIKTYTEVAPYPSAQVLGQEIFQSGL 402 >SB_27982| Best HMM Match : Cu2_monooxygen (HMM E-Value=2.9e-07) Length = 245 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +1 Query: 238 EHKXKAIG*ELRTNVFIISVMFGLSVNIHMRMFRSGLKYFYTDS 369 +H +G + + F++ V + + ++ SG+++FYTDS Sbjct: 161 DHVGSPLGLDFQGRYFVMEVHYNNPDKLAGKIDNSGVRFFYTDS 204 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,693,760 Number of Sequences: 59808 Number of extensions: 209694 Number of successful extensions: 325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -