BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV1001.Seq (565 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 3.9 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 24 3.9 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 3.9 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +3 Query: 237 TKRSYKIFR*VT*INVHTSMIKSRYRPFIEIKKKNPHLIYQILISSTVFLPSLRSSFRIK 416 T +SYK+ + I H +++ + E +K NP+L + + T F + + FR Sbjct: 3026 TSKSYKVTNWINEIFEHFFNTENQGKQDQEDRKVNPYLKHHKRPTKTPF--HIANCFRTN 3083 Query: 417 TYYNLKT 437 + NL T Sbjct: 3084 SADNLNT 3090 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.8 bits (49), Expect = 3.9 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +2 Query: 53 NFKH*KI*HLFKWKSIRRLKTIKSKYCKKPLNP*RLLIDL--SPEIIERETI 202 NF+ K ++KW + L S C N RLL DL S I+ER + Sbjct: 7 NFQCYKQLRIYKWIIVLMLIANSSILCMAGYNEKRLLHDLLDSYNILERPVV 58 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 427,456 Number of Sequences: 2352 Number of extensions: 7001 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -