BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0997.Seq (558 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC777.02 |||transcription factor |Schizosaccharomyces pombe|ch... 26 3.3 SPAC15F9.03c |nxt2|nft2, ntf2, ntf2, nft2, SPAC1B9.01c|nuclear t... 25 5.7 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 25 10.0 >SPCC777.02 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 632 Score = 26.2 bits (55), Expect = 3.3 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 293 NKKEKHVLTPTLAX*DIHNQTNSPPNKFKIALMQKCPAQCSGSSFK 430 N+K++H T A S K K+A ++K P+ +G SFK Sbjct: 58 NRKKRHTKTYVEALESQLANMESTLAKIKVAPVEKIPSLLAGISFK 103 >SPAC15F9.03c |nxt2|nft2, ntf2, ntf2, nft2, SPAC1B9.01c|nuclear transport factor Nxt2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 123 Score = 25.4 bits (53), Expect = 5.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 240 FSNSFHALNTHKNMYVLGESLFLSY 166 +S FH +N + N YVL + L+Y Sbjct: 98 YSQVFHLVNNNGNYYVLNDLFRLNY 122 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 24.6 bits (51), Expect = 10.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 510 DNRMLSKDKCAXNYT 554 ++RML+K CA NYT Sbjct: 2488 EDRMLTKKPCALNYT 2502 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,072,546 Number of Sequences: 5004 Number of extensions: 39621 Number of successful extensions: 72 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -