BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0997.Seq (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26510.1 68415.m03181 xanthine/uracil permease family protein... 27 6.4 At1g02890.1 68414.m00256 AAA-type ATPase family protein contains... 27 6.4 At5g21900.1 68418.m02539 expressed protein 27 8.5 >At2g26510.1 68415.m03181 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 551 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 228 FHALNTHKNMYVLGESLFLS 169 F N+ +NMYV+G SLFLS Sbjct: 434 FTDTNSMRNMYVIGVSLFLS 453 >At1g02890.1 68414.m00256 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family; similar to mitochondrial sorting protein 1 (MSP1) (TAT-binding homolog 4) (Swiss-Prot:P28737) [Saccharomyces cerevisiae] Length = 1252 Score = 27.5 bits (58), Expect = 6.4 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Frame = +2 Query: 296 KKEKHVL-TPTLAX*DIHNQTNSPP---NKFKIALMQKCPAQCSGSSFKAVIMTWDNMQE 463 KKE+ V A +++ T+ P N FK A Q C + S SS + W+ + Sbjct: 1179 KKERSVAQAENRAMPQLYSSTDVRPLNMNDFKTAHDQVCASVASDSSNMNELQQWNELYG 1238 Query: 464 KIGEYNKIIL*YFI 505 + G K L YF+ Sbjct: 1239 EGGSRKKTSLSYFM 1252 >At5g21900.1 68418.m02539 expressed protein Length = 544 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 393 CIKAILNLFGGEFV*LCISXNAKVGVSTCFS 301 CI A L + GG LC++ VG T FS Sbjct: 430 CIAAFLEVSGGSLRELCLNKVRDVGPETAFS 460 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,181,403 Number of Sequences: 28952 Number of extensions: 185058 Number of successful extensions: 279 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 279 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -