BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0996.Seq (501 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60470.1 68418.m07584 zinc finger (C2H2 type) family protein ... 28 4.1 At4g09430.1 68417.m01553 disease resistance protein (TIR-NBS-LRR... 27 9.4 >At5g60470.1 68418.m07584 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 392 Score = 27.9 bits (59), Expect = 4.1 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 150 PKSQILQSECITSFWQKYSESWCTHVTLRNTFLSKNSNLILKVLIR 13 P S S+ + + W K E C H L N +++ N N+ K + + Sbjct: 212 PPSPRSTSDSVHNLW-KLQEEECAHQWLLNEYMNNNKNIFHKGIFK 256 >At4g09430.1 68417.m01553 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1039 Score = 26.6 bits (56), Expect = 9.4 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +2 Query: 2 NIENLIRTFNIKLEFFDRNVFRNVTCVHHDS 94 N+E ++R L++++++VF V C+ + S Sbjct: 414 NVEEILRASYDDLDYYEQSVFLQVACLFNGS 444 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,836,577 Number of Sequences: 28952 Number of extensions: 145142 Number of successful extensions: 279 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 279 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -