BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0995.Seq (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 2.3 AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 23 2.3 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 3.1 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 22 4.1 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 22 4.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.1 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/27 (29%), Positives = 11/27 (40%) Frame = +2 Query: 266 MGWNWTAEDIPGMKPRPKWKPGAANKI 346 M WN + + G W P A N + Sbjct: 439 MNWNMPSTSVVGDMLNMNWNPSAQNDL 465 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 22.6 bits (46), Expect = 2.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 247 YGYLISCFFSTTTGSMLIAFRGYFSFSLT 161 +G+LI F G++ +AF G FS+T Sbjct: 326 FGFLIIQRFIHQIGTLEVAFTGKNFFSIT 354 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.2 bits (45), Expect = 3.1 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -3 Query: 360 YLLTNILLAAPGFHLGLGFIPGMSSAVQFHPMFFGKEDMDT 238 Y N + G + L FI +S + HP +FGK T Sbjct: 274 YCYYNSKMTKDGVYNTLFFIVYVSLLLGPHPTYFGKTGRKT 314 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.8 bits (44), Expect = 4.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 61 GRVSDPVVDSAKHCSC*GQC*QRSRFEPRELT 156 GR P V++ KH SC SR P E++ Sbjct: 342 GRKVSPRVNTIKHTSCIPTPNGDSRLPPLEIS 373 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.8 bits (44), Expect = 4.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 61 GRVSDPVVDSAKHCSC*GQC*QRSRFEPRELT 156 GR P V++ KH SC SR P E++ Sbjct: 342 GRKVSPRVNTIKHTSCIPTPNGDSRLPPLEIS 373 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 439 LNRQLWLPKKDREYTVQMEVL 501 +N + PK D YT++ E+L Sbjct: 832 INNKRLEPKGDNRYTIREEIL 852 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,664 Number of Sequences: 336 Number of extensions: 2319 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -