BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0995.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_38443| Best HMM Match : Lipoprotein_15 (HMM E-Value=0.14) 27 7.6 >SB_13461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = -3 Query: 369 KALYLLTNILLAAPGFHLGLGFIPGMSSAVQFHPMFFGKE 250 K LY + NI P FH LGF GM F+ + GKE Sbjct: 79 KELYAMRNI---RPSFHSKLGFYGGMLYTGIFYCLLRGKE 115 >SB_38443| Best HMM Match : Lipoprotein_15 (HMM E-Value=0.14) Length = 310 Score = 27.5 bits (58), Expect = 7.6 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 7/68 (10%) Frame = -3 Query: 396 WLKHLTPS---LKALYLLTNILLA----APGFHLGLGFIPGMSSAVQFHPMFFGKEDMDT 238 W KH+ + L L TN L A G+ LG + G S V H +FF +MD Sbjct: 199 WPKHMLNNGINLACFALFTNRLNAPRVITKGYTLGYIVLIGQSVLVTVHQLFFTATEMDD 258 Query: 237 *FPVSFQL 214 V F + Sbjct: 259 GMDVLFTM 266 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,950,029 Number of Sequences: 59808 Number of extensions: 281459 Number of successful extensions: 816 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 813 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -