BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0995.Seq (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 23 5.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.6 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.4 bits (48), Expect = 5.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 251 RIWIPDFLFLFNYNWFYADSLQR 183 +IW+PD F + N F D +R Sbjct: 96 KIWVPDTFFANDKNSFLHDVTER 118 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/36 (22%), Positives = 18/36 (50%) Frame = +2 Query: 221 KETGNQVSISSFPKNMGWNWTAEDIPGMKPRPKWKP 328 +E ++ + ++M + DIP + P P+ +P Sbjct: 2953 RELREELEARRYDRDMSTETSKRDIPNIPPAPEQQP 2988 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,345 Number of Sequences: 2352 Number of extensions: 9897 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -