BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0995.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 1.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 1.5 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 4.7 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 4.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.7 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 251 RIWIPDFLFLFNYNWFYADSLQR 183 +IW+PD F + N F D +R Sbjct: 115 KIWVPDTFFANDKNSFLHDVTER 137 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 125 NVPGLSPVSSPTRQGEAEITSEGYQHRTSCS 217 N G P+S RQ AE E H T+C+ Sbjct: 1061 NKVGSGPMSEERRQHTAEGVPEQPPHDTTCT 1091 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 439 LNRQLWLPKKDREYTVQMEVL 501 +N + PK D YT++ E+L Sbjct: 812 MNNKRLDPKSDSRYTIREEIL 832 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 240 YPYPPFQRTWDGI 278 Y YPP W GI Sbjct: 42 YQYPPLNPMWHGI 54 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 240 YPYPPFQRTWDGI 278 Y YPP W GI Sbjct: 8 YQYPPLNPMWHGI 20 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 92 AESTTGSETRPTEKIRQGTQ 33 A TTG+ T PT ++R+ Q Sbjct: 252 AAMTTGTTTIPTRRLRKRRQ 271 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,231 Number of Sequences: 438 Number of extensions: 2951 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -