BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0984.Seq (560 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060990-1|AAL28538.1| 461|Drosophila melanogaster HL01082p pro... 31 1.1 AF135119-1|AAD31715.1| 763|Drosophila melanogaster fat-spondin ... 31 1.1 AE013599-2411|AAM68494.2| 628|Drosophila melanogaster CG6953-PB... 31 1.1 AE013599-2409|AAF57910.1| 763|Drosophila melanogaster CG6953-PA... 31 1.1 >AY060990-1|AAL28538.1| 461|Drosophila melanogaster HL01082p protein. Length = 461 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 131 RGQCRPRKFSCWSTSTTSGSKIQAGHRRRSKSVLFPTHAD 250 R +CR +S WS + S K G R RS+ L+P AD Sbjct: 121 RAECRVGDYSAWSPCSVSCGK---GIRMRSRQYLYPAAAD 157 >AF135119-1|AAD31715.1| 763|Drosophila melanogaster fat-spondin protein. Length = 763 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 131 RGQCRPRKFSCWSTSTTSGSKIQAGHRRRSKSVLFPTHAD 250 R +CR +S WS + S K G R RS+ L+P AD Sbjct: 423 RAECRVGDYSAWSPCSVSCGK---GIRMRSRQYLYPAAAD 459 >AE013599-2411|AAM68494.2| 628|Drosophila melanogaster CG6953-PB, isoform B protein. Length = 628 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 131 RGQCRPRKFSCWSTSTTSGSKIQAGHRRRSKSVLFPTHAD 250 R +CR +S WS + S K G R RS+ L+P AD Sbjct: 288 RAECRVGDYSAWSPCSVSCGK---GIRMRSRQYLYPAAAD 324 >AE013599-2409|AAF57910.1| 763|Drosophila melanogaster CG6953-PA, isoform A protein. Length = 763 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 131 RGQCRPRKFSCWSTSTTSGSKIQAGHRRRSKSVLFPTHAD 250 R +CR +S WS + S K G R RS+ L+P AD Sbjct: 423 RAECRVGDYSAWSPCSVSCGK---GIRMRSRQYLYPAAAD 459 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,073,059 Number of Sequences: 53049 Number of extensions: 464794 Number of successful extensions: 948 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 948 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2172596895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -