SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0981.Seq
         (566 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ370036-1|ABD18597.1|  103|Anopheles gambiae putative TIL domai...    23   6.9  
AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s...    23   6.9  

>DQ370036-1|ABD18597.1|  103|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 103

 Score = 23.0 bits (47), Expect = 6.9
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +2

Query: 158 GNLCIWTKKC 187
           G  CIW KKC
Sbjct: 84  GGSCIWAKKC 93


>AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl
           symporter protein.
          Length = 1127

 Score = 23.0 bits (47), Expect = 6.9
 Identities = 11/37 (29%), Positives = 21/37 (56%)
 Frame = +1

Query: 454 TKMISVKTMLMGTLIRNFPDTAPY*IVTFSIINFTXF 564
           T +ISV  +L+G L    P  + + +  + ++NF+ F
Sbjct: 556 TFVISVAVILVGDLNMIAPLISNFFLAAYCLVNFSTF 592


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 537,066
Number of Sequences: 2352
Number of extensions: 9793
Number of successful extensions: 11
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 53404389
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -