BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0979.Seq (561 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44426| Best HMM Match : Lectin_legB (HMM E-Value=4.8) 28 6.0 SB_26929| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_23384| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 >SB_44426| Best HMM Match : Lectin_legB (HMM E-Value=4.8) Length = 439 Score = 27.9 bits (59), Expect = 6.0 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +2 Query: 377 LKEEPHRYYL-KKVSLKNLFTKIAR-TEEYEISHTYREYRE 493 +K PH++YL KK+ +K L +AR EE+ T R E Sbjct: 271 IKSSPHKFYLYKKMDIKALQQDMARAAEEFSRHCTERSLEE 311 >SB_26929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 313 KMNIPKIRMIFDYEFRRRTKLQKQLAISMLHLERGLVMN 197 K +I RM DY RR+ K +K++ ++ +RGL +N Sbjct: 72 KSSIQPSRMDQDYSIRRQQKDKKEITPNLPRTKRGLRIN 110 >SB_23384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 27.9 bits (59), Expect = 6.0 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +3 Query: 75 SDRLPPSLSIQCYSDGGSSTWLVLQIKISITKAFKPKSHGAFITSPLS 218 SD +P SL + C SDG ST +V + + F P S G I+SP + Sbjct: 11 SDDIPSSL-VACESDGIPSTLVVCEFNGIPSPLFAPVSDG--ISSPFT 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,575,703 Number of Sequences: 59808 Number of extensions: 317204 Number of successful extensions: 950 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -