BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0978.Seq (560 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g11630.1 68416.m01425 2-cys peroxiredoxin, chloroplast (BAS1)... 90 1e-18 At5g06290.1 68418.m00705 2-cys peroxiredoxin, chloroplast, putat... 89 2e-18 At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to pe... 46 1e-05 At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putati... 34 0.075 At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol spe... 32 0.30 At3g62170.1 68416.m06985 pectinesterase family protein contains ... 29 2.1 At5g61850.1 68418.m07760 floral meristem identity control protei... 28 4.9 At1g80910.1 68414.m09493 expressed protein 28 4.9 At4g28395.1 68417.m04064 lipid transfer protein, putative identi... 27 6.5 At2g01190.1 68415.m00030 octicosapeptide/Phox/Bem1p (PB1) domain... 27 8.6 >At3g11630.1 68416.m01425 2-cys peroxiredoxin, chloroplast (BAS1) identical to SP|Q96291 2-cys peroxiredoxin BAS1, chloroplast precursor {Arabidopsis thaliana}; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 266 Score = 89.8 bits (213), Expect = 1e-18 Identities = 43/80 (53%), Positives = 55/80 (68%) Frame = +1 Query: 271 DSHFTHLAWINTPRKQGGLGPMNIPLISDKXHRIXRDYGVLDEETGIPFRGLFIIDDKQN 450 DS F+HLAW+ T RK GGLG +N PLISD I + +GVL + GI RGLFIID + Sbjct: 146 DSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGV 205 Query: 451 LXLITINDLPVXRSVEETLR 510 + TIN+L + RSV+ET+R Sbjct: 206 IQHSTINNLGIGRSVDETMR 225 Score = 79.8 bits (188), Expect = 1e-15 Identities = 40/69 (57%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = +3 Query: 51 MPLQMTKPAPQFKATXVVNGEFKDISLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSEKA 227 +PL K AP F+A V + EF + LSDY GK YV+LFFYPLDFTFVCPTEI AFS++ Sbjct: 72 LPLVGNK-APDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 130 Query: 228 DEFRXIGCE 254 EF + E Sbjct: 131 SEFEKLNTE 139 >At5g06290.1 68418.m00705 2-cys peroxiredoxin, chloroplast, putative very strong similarity to SP|Q96291 2-cys peroxiredoxin BAS1, chloroplast precursor {Arabidopsis thaliana}; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 273 Score = 88.6 bits (210), Expect = 2e-18 Identities = 42/80 (52%), Positives = 55/80 (68%) Frame = +1 Query: 271 DSHFTHLAWINTPRKQGGLGPMNIPLISDKXHRIXRDYGVLDEETGIPFRGLFIIDDKQN 450 DS F+HLAW+ T RK GGLG +N PL+SD I + +GVL + GI RGLFIID + Sbjct: 153 DSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEGV 212 Query: 451 LXLITINDLPVXRSVEETLR 510 + TIN+L + RSV+ET+R Sbjct: 213 IQHSTINNLGIGRSVDETMR 232 Score = 79.0 bits (186), Expect = 2e-15 Identities = 39/69 (56%), Positives = 49/69 (71%), Gaps = 1/69 (1%) Frame = +3 Query: 51 MPLQMTKPAPQFKATXVVNGEFKDISLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSEKA 227 +PL K AP F+A V + EF + LS+Y GK YV+LFFYPLDFTFVCPTEI AFS++ Sbjct: 79 LPLVGNK-APDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRY 137 Query: 228 DEFRXIGCE 254 +EF + E Sbjct: 138 EEFEKLNTE 146 >At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to peroxiredoxin Q [Sedum lineare] GI:6899842; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +3 Query: 117 KDISLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRXIGCE 254 K +SL YKGK VVL+FYP D T C + AF + ++F+ G E Sbjct: 86 KPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAE 131 Score = 35.1 bits (77), Expect = 0.032 Identities = 17/59 (28%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 346 LISDKXHRIXRDYGVLDEETG-IPFRGLFIIDDKQNLXLITINDLPVXRSVEETLRWCK 519 L+SD+ +++ +D+GV + G +P R +++D + LI N + ++ETL++ K Sbjct: 156 LLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLK 214 >At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putative identical to peroxiredoxin (Rehydrin homolog) [Arabidopsis thaliana] SWISS-PROT:O04005; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 33.9 bits (74), Expect = 0.075 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 129 LSDY-KGKYVVLFFYPLDFTFVCPTEIIAFSEKADEF 236 L DY + VLF +P DFT VC TE+ A ++ A EF Sbjct: 24 LHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEF 60 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/76 (23%), Positives = 30/76 (39%) Frame = +1 Query: 283 THLAWINTPRKQGGLGPMNIPLISDKXHRIXRDYGVLDEETGIPFRGLFIIDDKQNLXLI 462 +H WI +N P+I+D I ++D P R L I+ + L Sbjct: 77 SHKDWIKDIEAFNHGSKVNYPIIADPNKEIIPQLNMIDPIENGPSRALHIVGPDSKIKLS 136 Query: 463 TINDLPVXRSVEETLR 510 + R+++E LR Sbjct: 137 FLYPSTTGRNMDEVLR 152 >At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol specific antioxidant (AhpC/TSA)/mal allergen family protein identical to SP|Q9M7T0 Putative peroxiredoxin, mitochondrial precursor {Arabidopsis thaliana}; similar to thioredoxin peroxidase [Capsicum annuum] GI:18654477; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 201 Score = 31.9 bits (69), Expect = 0.30 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +3 Query: 102 VNGEFKDISLSD-YKGKYVVLFFYPLDFTFVCPTE-IIAFSEKADEFRXIGCE 254 V+ +F LSD +KGK VV+F P +T VC + + ++ D+F+ G + Sbjct: 58 VSSKFSTTPLSDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGID 110 >At3g62170.1 68416.m06985 pectinesterase family protein contains Pfam profiles: PF01095 pectinesterase, PF04043 plant invertase/pectin methylesterase inhibitor ;similar to pollen-specific pectin esterase GI:1620652 from [Brassica rapa subsp. pekinensis] Length = 588 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 155 NIFPLVVRQRNVLELSVDDXRGLELGSGFGHLQRHLVETKD 33 +IF VV + + VDD + + +G+G G R L+E D Sbjct: 192 DIFHSVVTAMAQMGVKVDDMKNITMGAGAGGAARRLLEDND 232 >At5g61850.1 68418.m07760 floral meristem identity control protein LEAFY (LFY) identical to PIR|B38104 LFY floral meristem identity control protein, splice form 2 - Arabidopsis thaliana; contains Pfam profile PF01698: Floricaula / Leafy protein Length = 420 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/65 (27%), Positives = 23/65 (35%) Frame = +3 Query: 306 AAQAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPXADHDQRPARX 485 A +A R R E ++ HL + G H+L EP DQ A Sbjct: 110 AVRAERRRLQEEEEEESSRRRHLLLSAAGDSGTHHALDALSQEGLSEEPVQQQDQTDAAG 169 Query: 486 EVGGG 500 GGG Sbjct: 170 NNGGG 174 >At1g80910.1 68414.m09493 expressed protein Length = 497 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 120 DISLSDYKGKYV--VLFFYPLDFTFVCPTEIIAFSE 221 D+ ++G+ + +LFFYP D TF +I SE Sbjct: 19 DLRRGQHEGQELDKILFFYPPDLTFSTQLSVIGLSE 54 >At4g28395.1 68417.m04064 lipid transfer protein, putative identical to anther-specific gene ATA7 [gi:2746339]; contains Pfam protease inhibitor/seed storage/LTP family domain Length = 180 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 371 MRCXLSLIRGMFMGPSPPCLRGVLIQARCVKCES 270 M C + + G+F PSP C RGV VK S Sbjct: 77 MPC-MGFVEGIFQQPSPDCCRGVTHLNNVVKFTS 109 >At2g01190.1 68415.m00030 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein Pfam profile PF00564: PB1 domain Length = 720 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +3 Query: 303 HAAQAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLP 419 H QAG +P S + + P + G GH LP Sbjct: 389 HGVQAGYRKPPTPRSQPQNLPPQQAHQLKSNSGGGHELP 427 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,918,946 Number of Sequences: 28952 Number of extensions: 166177 Number of successful extensions: 478 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -