BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0975.Seq (565 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 3.9 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 5.2 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 5.2 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 5.2 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 23 5.2 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 23 9.1 AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. 23 9.1 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 23 9.1 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 23 9.1 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 23 9.1 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 23 9.1 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 23 9.1 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 23 9.1 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 23 9.1 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 23 9.1 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 9.1 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 9.1 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 3.9 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 2 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 148 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.4 bits (48), Expect = 5.2 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 2 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 148 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.4 bits (48), Expect = 5.2 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 2 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 148 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 29 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 5.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 424 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 335 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.4 bits (48), Expect = 5.2 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = -1 Query: 181 CFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFKC 2 C + + PV +R R + RG +R+ PVD A +A KC Sbjct: 373 CISSIMEAMPVSVDRQRCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCTSEIKC 432 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/32 (25%), Positives = 15/32 (46%) Frame = +1 Query: 439 YQSQRFHPVRHCNYEDYGLHQVLIWELVYDHG 534 + +Q +HP +G V++W + HG Sbjct: 162 FPNQAYHPKNTIKTLSHGGGHVMVWGCFFWHG 193 >AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. Length = 90 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 64 AYTPPSLSNIHALGAFKRF 8 A+T PS+ N H AF+ F Sbjct: 64 AFTNPSVINSHTTAAFRFF 82 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = -3 Query: 242 HKSSRISRVSPNFPINLYEALFHNFQDFVSGQSILQTI 129 H S + + +P F +N+Y+ L D +G ++ + Sbjct: 80 HLHSSVGKSAPQFLLNVYDQLQQEETDAPAGAGRIRKV 117 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 61 MHRDRQPVPTSCASAC 108 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 61 MHRDRQPVPTSCASAC 108 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 61 MHRDRQPVPTSCASAC 108 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 61 MHRDRQPVPTSCASAC 108 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 61 MHRDRQPVPTSCASAC 108 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 61 MHRDRQPVPTSCASAC 108 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 9.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 61 MHRDRQPVPTSCASAC 108 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 132 DSSGKSPGASTRATCGDRLTVSVHT 58 D++ +PGAS A RL VH+ Sbjct: 885 DANASNPGASRYARWAHRLIPEVHS 909 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 101 VLAPGDFPEESSEV 142 VLAPG PEES+ V Sbjct: 683 VLAPGRTPEESAAV 696 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,731 Number of Sequences: 2352 Number of extensions: 14149 Number of successful extensions: 72 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -