BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0972.Seq (399 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 45 2e-05 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 44 6e-05 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 44 6e-05 SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 43 8e-05 SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 42 1e-04 SB_15403| Best HMM Match : CH (HMM E-Value=0) 41 4e-04 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 40 6e-04 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 40 7e-04 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 40 7e-04 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 39 0.002 SB_22525| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 38 0.002 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 38 0.004 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.016 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 35 0.021 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.021 SB_12293| Best HMM Match : OATP (HMM E-Value=0) 35 0.021 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.021 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 35 0.021 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 35 0.028 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.037 SB_29074| Best HMM Match : Kazal_2 (HMM E-Value=3.3e-16) 33 0.065 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_57638| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-11) 32 0.20 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 31 0.35 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 31 0.35 SB_27078| Best HMM Match : Kazal_2 (HMM E-Value=7.6e-07) 30 0.80 SB_56344| Best HMM Match : Kazal_2 (HMM E-Value=1.5e-09) 30 0.80 SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) 30 0.80 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 29 1.1 SB_5272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_33373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_5367| Best HMM Match : wnt (HMM E-Value=0) 29 1.8 SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) 28 2.4 SB_44627| Best HMM Match : Kazal_1 (HMM E-Value=3.19496e-43) 28 3.2 SB_47527| Best HMM Match : Alpha_E2_glycop (HMM E-Value=2.4) 27 4.3 SB_43077| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) 27 4.3 SB_7030| Best HMM Match : Kazal_2 (HMM E-Value=4.6e-08) 27 4.3 SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_16978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_25971| Best HMM Match : Sushi (HMM E-Value=0.54) 27 5.6 SB_25348| Best HMM Match : Kazal_1 (HMM E-Value=5.3e-09) 27 5.6 SB_14008| Best HMM Match : Kazal_1 (HMM E-Value=5.3e-09) 27 5.6 SB_9401| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_51362| Best HMM Match : Disintegrin (HMM E-Value=4.4) 27 7.4 SB_49500| Best HMM Match : Collagen (HMM E-Value=1.8e-07) 27 7.4 SB_40708| Best HMM Match : SRCR (HMM E-Value=0) 27 7.4 SB_38490| Best HMM Match : Neur_chan_LBD (HMM E-Value=2e-24) 27 7.4 SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) 26 9.8 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 26 9.8 SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05) 26 9.8 SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) 26 9.8 SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) 26 9.8 SB_9563| Best HMM Match : Kazal_1 (HMM E-Value=1.7e-07) 26 9.8 SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) 26 9.8 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 26 9.8 SB_52825| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_37964| Best HMM Match : Bowman-Birk_leg (HMM E-Value=4.5) 26 9.8 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 26 9.8 SB_31752| Best HMM Match : Bac_surface_Ag (HMM E-Value=0.0069) 26 9.8 SB_27602| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 26 9.8 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_12693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0014) 26 9.8 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 48.4 bits (110), Expect = 2e-06 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 6/41 (14%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR---CAKAIF---AYDGPC 191 CT EY PVCGT+G TYGN+C++R C K+ AY G C Sbjct: 1299 CTYEYMPVCGTDGKTYGNKCEMRASACLKSTMVTVAYPGEC 1339 Score = 37.9 bits (84), Expect = 0.003 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = +3 Query: 45 LVACCTLGAESTCIC-----TTEYRPVCGTNGVTYGNRCQLRCA 161 LV C + + C+C T +Y PVC ++G TY N C + A Sbjct: 1798 LVTCINMNGSAACVCQPRPCTADYSPVCASDGQTYPNVCTMDSA 1841 Score = 36.3 bits (80), Expect = 0.009 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 69 AESTC--ICTTEYRPVCGTNGVTYGNRCQLRCA 161 A+ C IC Y PVCG++G Y N C +R A Sbjct: 1363 AQCVCPSICPLHYSPVCGSDGNMYSNECAMRAA 1395 Score = 35.9 bits (79), Expect = 0.012 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQL 152 C + +TC C + Y PVC +NG TY NRC + Sbjct: 1585 CLLVNGTATCECFSACPDIYDPVCASNGKTYSNRCDM 1621 Score = 31.9 bits (69), Expect = 0.20 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 69 AESTC--ICTTEYRPVCGTNGVTYGNRCQLRCA 161 AE C + T EYRPVC ++G Y NR + A Sbjct: 1965 AECVCRTVTTLEYRPVCASDGKIYPNRMTMENA 1997 Score = 30.3 bits (65), Expect = 0.60 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCIC----TTEYRPVCGTNGVTYGNRCQLRCA 161 C + + C C T +Y PVC ++G TY NR + A Sbjct: 1512 CHNIDNTAVCKCRQMMTADYTPVCASDGKTYPNRMSMENA 1551 Score = 29.9 bits (64), Expect = 0.80 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 84 ICTTEYRPVCGTNGVTYGNRCQLR 155 IC+ PVCG++G Y + C+LR Sbjct: 1758 ICSPVISPVCGSDGKIYKDDCELR 1781 Score = 28.3 bits (60), Expect = 2.4 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +3 Query: 54 CCTLGAESTCICTTEYRP-----VCGTNGVTYGNRCQLR 155 C E C C P VCG++G TY N C L+ Sbjct: 1878 CVVRSGEPMCECVVNECPKNSSKVCGSDGWTYDNECFLK 1916 Score = 26.6 bits (56), Expect = 7.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQL 152 C+ VCG++ +TY N C L Sbjct: 1445 CSANRSDVCGSDRMTYSNECTL 1466 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 45.2 bits (102), Expect = 2e-05 Identities = 22/41 (53%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQL---RC---AKAIFAYDGPC 191 CT EY+P CGT+G TY NRC L C K A+DGPC Sbjct: 283 CTREYKPACGTDGNTYPNRCVLAIQSCETGEKLQLAHDGPC 323 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 9/55 (16%) Frame = +3 Query: 54 CCTLGAESTC----ICTTEYRPVCGTNGVTYGNRCQLRCAKA-----IFAYDGPC 191 C + +TC CT E PVCGT+ TY N C L A + A++GPC Sbjct: 107 CVNVNGTATCECPRACTRELMPVCGTDQKTYDNMCLLERAACKDDGLMLAHEGPC 161 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 12/58 (20%) Frame = +3 Query: 54 CCTLGAESTC----ICTTEYRPVCGTNGVTYGNRCQLR---CA-----KAIFAYDGPC 191 C + +TC +CT +Y PVCG++ TY N C L C K +DGPC Sbjct: 185 CVEVNGTATCECPKVCTLDYTPVCGSDNKTYANLCNLEVEACKPENTDKLQLLHDGPC 242 Score = 37.1 bits (82), Expect = 0.005 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQL 152 CT EY PVCG++G TY N C L Sbjct: 46 CTREYAPVCGSDGKTYPNPCAL 67 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 43.6 bits (98), Expect = 6e-05 Identities = 17/42 (40%), Positives = 28/42 (66%), Gaps = 4/42 (9%) Frame = +3 Query: 57 CTLGAESTC----ICTTEYRPVCGTNGVTYGNRCQLRCAKAI 170 C++ ++TC ICT EY P+CG++G TY N+C++ A + Sbjct: 5144 CSVNNKATCSCPDICTFEYSPLCGSDGKTYDNQCEMERASCL 5185 Score = 41.5 bits (93), Expect = 2e-04 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = +3 Query: 78 TC--ICTTEYRPVCGTNGVTYGNRCQLRCA 161 TC ICT EY PVCGT+G +Y N C L+ A Sbjct: 5223 TCNSICTLEYAPVCGTDGQSYDNECLLQTA 5252 Score = 37.1 bits (82), Expect = 0.005 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +3 Query: 84 ICTTEYRPVCGTNGVTYGNRCQLRCA 161 IC+ Y PVCGT+G Y N C L+ A Sbjct: 5298 ICSLVYAPVCGTDGQEYSNECNLQIA 5323 Score = 37.1 bits (82), Expect = 0.005 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C+ +Y PVCGT+G TY N C L+ Sbjct: 5555 CSLDYTPVCGTDGETYENECTLQ 5577 Score = 36.7 bits (81), Expect = 0.007 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +3 Query: 54 CCTLGAESTCICTT---EYRPVCGTNGVTYGNRCQLR 155 C + ++ C+C + +PVCG++G TY N C+LR Sbjct: 5610 CVLIRGQAVCMCQSCPSINKPVCGSDGKTYNNECELR 5646 Score = 32.3 bits (70), Expect = 0.15 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +3 Query: 69 AESTCI-CTTEYRPVCGTNGVTYGNRCQLR 155 A TC+ C PVCG++G Y N C LR Sbjct: 5786 AVCTCLSCPNILDPVCGSDGKNYDNECNLR 5815 Score = 27.9 bits (59), Expect = 3.2 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 5994 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 6053 Query: 192 CG 197 G Sbjct: 6054 SG 6055 Score = 27.9 bits (59), Expect = 3.2 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 6066 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 6125 Query: 192 CG 197 G Sbjct: 6126 SG 6127 Score = 27.9 bits (59), Expect = 3.2 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 6282 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 6341 Query: 192 CG 197 G Sbjct: 6342 SG 6343 Score = 27.9 bits (59), Expect = 3.2 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 6597 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 6656 Query: 192 CG 197 G Sbjct: 6657 SG 6658 Score = 27.5 bits (58), Expect = 4.3 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 5370 CKVQDDKPTCVCIEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 5429 Query: 192 CG 197 G Sbjct: 5430 SG 5431 Score = 27.5 bits (58), Expect = 4.3 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 14/54 (25%) Frame = +3 Query: 78 TCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPCCG 197 TC+C +PV G++G Y N C L+ A + + A Y GPC G Sbjct: 5858 TCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSG 5911 Score = 27.5 bits (58), Expect = 4.3 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 6210 CKVQDDKPTCVCVEPCPEILKPVYGSDGRDYDNECLLKLAACKSKSRILIAGFGRYPGPC 6269 Query: 192 CG 197 G Sbjct: 6270 SG 6271 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 5442 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 5481 Score = 27.1 bits (57), Expect = 5.6 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLR---C---AKAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ C ++ + A Y GPC Sbjct: 5922 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLTACKSKSRILIAGFGRYPGPC 5981 Query: 192 CG 197 G Sbjct: 5982 SG 5983 Score = 27.1 bits (57), Expect = 5.6 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLR---C---AKAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ C ++ + A Y GPC Sbjct: 6138 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLSACKSKSRILIAGFGRYPGPC 6197 Query: 192 CG 197 G Sbjct: 6198 SG 6199 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 6354 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 6393 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 6437 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 6476 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 6525 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 6564 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 6669 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 6708 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 43.6 bits (98), Expect = 6e-05 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 CT YRPVCGT+G TYGN+C L A Sbjct: 43 CTKIYRPVCGTDGKTYGNKCVLEIA 67 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 43.2 bits (97), Expect = 8e-05 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +3 Query: 72 ESTCICTTEYRPVCGTNGVTYGNRCQLRCA 161 +S +CT +Y PVCG++G TYGN C L+ A Sbjct: 27 DSPTLCTLQYDPVCGSDGKTYGNMCFLKAA 56 >SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 42.7 bits (96), Expect = 1e-04 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAKAIFAYDGPC 191 C + +PVCG NG TY + C A+ + Y+GPC Sbjct: 223 CKSPTKPVCGVNGETYSSICGAHSARVVVDYEGPC 257 Score = 30.3 bits (65), Expect = 0.60 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 Query: 57 CTLGAESTCICTTEYRPVCGTNGVTYGNRCQLRCAKAIFAYDGPC 191 C L S+ + PVC T+G + N C L AY G C Sbjct: 175 CLLSPASSYCKDMQLEPVCDTDGQQHPNLCSLHFQGKKLAYKGFC 219 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 42.3 bits (95), Expect = 1e-04 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +3 Query: 9 KTMKTSIVLIFLLVACCTLGAESTC--ICTTEYRPVCGTNGVTYGNRCQLRCA 161 KT+ T ++ + C C IC Y+PVCG++ VTY N C LR A Sbjct: 2 KTLWTLLLAVMAASFCAKGSRPDKCAPICNKMYQPVCGSDNVTYSNPCMLRSA 54 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 40.7 bits (91), Expect = 4e-04 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 9/50 (18%) Frame = +3 Query: 57 CTLGAE--STCIC----TTEYRPVCGTNGVTYGNRCQL---RCAKAIFAY 179 C GA+ + C+C T EY PVCG++G TY N C L RC F Y Sbjct: 712 CQAGADGKTKCVCSAACTREYAPVCGSDGNTYNNLCLLTAARCQSQTFIY 761 Score = 32.7 bits (71), Expect = 0.11 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +3 Query: 66 GAESTC----ICTTEYRPVCGTNGVTYGNRCQLR 155 GA TC C VCGT+G+TY N C+LR Sbjct: 1302 GAVCTCPDPAACPLVKSRVCGTDGITYDNLCRLR 1335 Score = 29.5 bits (63), Expect = 1.1 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = +3 Query: 57 CTLGAESTCICTTE------YRPVCGTNGVTYGNRCQLRCA 161 C GA++ C + Y P+CGT+G TY N L A Sbjct: 1223 CVQGADNYARCECDLRPDPAYDPICGTDGKTYNNDKDLESA 1263 Score = 29.1 bits (62), Expect = 1.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C + PVCG +G TY N C L+ Sbjct: 977 CPSVNYPVCGDDGQTYDNECLLQ 999 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 40.3 bits (90), Expect = 6e-04 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C +E +PVCGT+GVTY N C LR Sbjct: 602 CPSEVKPVCGTDGVTYDNLCSLR 624 Score = 36.7 bits (81), Expect = 0.007 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTT----EYRPVCGTNGVTYGNRCQLRCA 161 C ++ TC+C + PVCG++G TY N C +R A Sbjct: 1057 CVSVDGTPTCVCPRRCPKKLMPVCGSDGKTYNNECLMRAA 1096 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 361 CEKVYDPVYGSDGKNYDNECELKRA 385 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 443 CEKVYDPVYGSDGKNYDNECELKRA 467 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 764 CEKVYDPVYGSDGKNYDNECELKRA 788 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 883 CEKVYDPVYGSDGKNYDNECELKRA 907 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 1377 CEKVYDPVYGSDGKNYDNECELKRA 1401 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 1449 CEKVYDPVYGSDGKNYDNECELKRA 1473 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 1531 CEKVYDPVYGSDGKNYDNECELKRA 1555 Score = 27.9 bits (59), Expect = 3.2 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 60 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 119 Query: 192 CG 197 G Sbjct: 120 SG 121 Score = 27.9 bits (59), Expect = 3.2 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 132 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 191 Query: 192 CG 197 G Sbjct: 192 SG 193 Score = 27.9 bits (59), Expect = 3.2 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +3 Query: 21 TSIVLIFLLVACCTLGAESTCICTT---EYRPVCGTNGVTYGNRCQLR 155 T+ V C + E+ C C + PVCG++G Y + C L+ Sbjct: 263 TNAVCTAPFAICLAVEREAICTCRSCPLINIPVCGSDGAQYDSECALQ 310 Score = 26.2 bits (55), Expect = 9.8 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 10/47 (21%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPCCG 197 C +PV G++G Y N C L+ A + + A Y GPC G Sbjct: 3 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSG 49 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 39.9 bits (89), Expect = 7e-04 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +3 Query: 84 ICTTEYRPVCGTNGVTYGNRCQLRCA 161 IC YRPVCG++ VTY N C LR A Sbjct: 43 ICPKIYRPVCGSDNVTYSNPCMLRSA 68 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 39.9 bits (89), Expect = 7e-04 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAKA------IFAYDGPC 191 C Y PVCGT+G TYGN+C L A AY G C Sbjct: 48 CPAIYMPVCGTDGKTYGNKCMLGAATCRSNGTITLAYPGEC 88 Score = 39.9 bits (89), Expect = 7e-04 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +3 Query: 51 ACCTLGAESTCICTTEYRPVCGTNGVTYGNRCQLRCA 161 AC + + IC Y+PVCG++ VTY N C LR A Sbjct: 161 ACGSRPDKCAPICNKMYQPVCGSDNVTYSNPCMLRSA 197 Score = 35.1 bits (77), Expect = 0.021 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 66 GAESTCI--CTTEYRPVCGTNGVTYGNRCQLRCA 161 G+ C+ CT E PVCG++G TY N C + A Sbjct: 113 GSSLRCMRRCTKELNPVCGSDGKTYDNPCVFKIA 146 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +3 Query: 54 CCTLGAESTCICTT----EYRPVCGTNGVTYGNRCQL 152 C A ++CIC T ++ PVCG +GVTY N C L Sbjct: 568 CSASSANASCICPTNCPSDWDPVCGDDGVTYQNLCHL 604 Score = 37.1 bits (82), Expect = 0.005 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 12/58 (20%) Frame = +3 Query: 57 CTLGAEST--CICTT----EYRPVCGTNGVTYGNRCQL---RCAKAI---FAYDGPCC 194 C + + T CIC T Y PVCG+N TY N C L C K + AY G CC Sbjct: 1810 CEIQEDGTEVCICPTYCRLNYDPVCGSNRKTYLNFCSLTAEACKKNLPIKMAYKGRCC 1867 Score = 34.7 bits (76), Expect = 0.028 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C E PVCG++G TY N C+LR Sbjct: 513 CPKEASPVCGSDGKTYENECKLR 535 Score = 33.5 bits (73), Expect = 0.065 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +3 Query: 66 GAESTC--ICTTEYRPVCGTNGVTYGNRCQLR 155 G + +C C +PVCG++G +YG+ C+LR Sbjct: 1677 GIKCSCPIYCPPSGQPVCGSDGKSYGSECELR 1708 Score = 33.1 bits (72), Expect = 0.086 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C +E RPVC ++G TY N C +R Sbjct: 890 CPSELRPVCASDGRTYVNECVMR 912 Score = 32.7 bits (71), Expect = 0.11 Identities = 23/72 (31%), Positives = 29/72 (40%), Gaps = 6/72 (8%) Frame = +3 Query: 51 ACCTLGAESTCICTTEYRPVCGTNGVTYGNRCQLR---CAKAI---FAYDGPCCGGMRI* 212 A CT ++C + PVCGT+ Y N C L CA I GPC GG + Sbjct: 807 AVCTCPDVASCDKMPD--PVCGTDNKEYANECLLNVAACAANIHLRVLNKGPCGGGCALY 864 Query: 213 GCQTSRISRDVP 248 C + P Sbjct: 865 KCHQFATCNEAP 876 Score = 32.7 bits (71), Expect = 0.11 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Frame = +3 Query: 72 ESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 ++ C+CT Y P+C +NG T+ N+C L A Sbjct: 1356 QAKCVCTKSCPLSYEPLCASNGKTFPNQCALDMA 1389 Score = 31.9 bits (69), Expect = 0.20 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR---C---AKAIFAYDGPC 191 C Y+PVCGT+ T+ N C L+ C + AY GPC Sbjct: 1542 CPLVYKPVCGTDMETHINACLLKLKSCQIESDLDVAYSGPC 1582 Score = 31.5 bits (68), Expect = 0.26 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 CT + VCG+NG TY N C LR Sbjct: 1895 CTFAFDAVCGSNGRTYINDCLLR 1917 Score = 30.7 bits (66), Expect = 0.46 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C ++RPVCG++ TY N C+L+ Sbjct: 442 CPRDFRPVCGSDLRTYVNLCRLQ 464 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 51 ACCTLGAESTCICTTEYRPVCGTNGVTYGNRCQLR 155 A C S C + + VCG+NG TY N C L+ Sbjct: 951 AQCVCPQTSECPVASSF--VCGSNGKTYTNECLLK 983 Score = 29.1 bits (62), Expect = 1.4 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRC---QLRCAKAIFAY 179 C+ PVCG++ V+Y N+C L C K + Y Sbjct: 1150 CSDLNTPVCGSDKVSYRNKCYMIALNCPKNKYVY 1183 Score = 29.1 bits (62), Expect = 1.4 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 63 LGAESTCI--CTTEYRPVCGTNGVTYGNRCQLR 155 L A TC C Y +CG++GV+Y + C +R Sbjct: 1604 LKARCTCPERCPLTYNLICGSDGVSYLSACAMR 1636 Score = 29.1 bits (62), Expect = 1.4 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 7/43 (16%) Frame = +3 Query: 63 LGAESTCIC----TTEYRPVCGTNGVTYGNRCQLR---CAKAI 170 + ++C C T +Y PVCG +G +Y + C L+ C K + Sbjct: 1745 VNGSASCQCPECRTLKYTPVCGDDGKSYLSTCMLKRLACLKGV 1787 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQL 152 C+ PVCG++G Y +RC L Sbjct: 1294 CSDVIEPVCGSDGKDYRSRCFL 1315 Score = 26.2 bits (55), Expect = 9.8 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +3 Query: 33 LIFLLVACCTLGAESTCICTTEYRPVCGTNGVTYGNRC 146 L LL CT G + PVC ++G TY N C Sbjct: 601 LCHLLREACTSGRIIRRLYRGVCDPVCASDGRTYQNEC 638 >SB_22525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 674 Score = 38.3 bits (85), Expect = 0.002 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = +3 Query: 60 TLGA-ESTCICTT-EYRPVCGTNGVTYGNRCQLRCAKAI 170 TLGA S C C+T ++RPVCG +GV+Y + C C ++ Sbjct: 456 TLGACNSACHCSTAQFRPVCGPDGVSYYSPCFAGCKASL 494 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 38.3 bits (85), Expect = 0.002 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y P+CGT+G TYGN+C L A Sbjct: 43 CKKIYSPMCGTDGKTYGNKCMLEIA 67 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 37.5 bits (83), Expect = 0.004 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAKAI 170 C + PVCG++GVTY ++C LR AK + Sbjct: 299 CRRKRDPVCGSDGVTYRSKCHLRVAKCL 326 Score = 34.7 bits (76), Expect = 0.028 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAK 164 C + +PVCG++G TY N C+L AK Sbjct: 240 CPKQDKPVCGSDGKTYTNGCELATAK 265 Score = 29.9 bits (64), Expect = 0.80 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAKAIFAYDG 185 C PVCG++ V+Y N C R A+ + G Sbjct: 39 CPRILTPVCGSDRVSYSNMCAFRNAQCLAVEQG 71 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAKAIFAYDG 185 C + RP+CG + TY N C AK DG Sbjct: 183 CDLKNRPICGEDEKTYRNLCLFLVAKCKAKKDG 215 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 37.5 bits (83), Expect = 0.004 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICT----TEYRPVCGTNGVTYGNRCQLRCA 161 C + + TC+C + +PVCG++G TY N C+L+ A Sbjct: 3959 CQAVNGQPTCVCNKNCPSTSKPVCGSDGKTYKNECELKRA 3998 Score = 32.7 bits (71), Expect = 0.11 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C + PVCG +G TY N C++R A Sbjct: 4241 CLPDKEPVCGADGKTYRNLCEIRKA 4265 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 225 CEKVYDPVYGSDGKNYDNECELKRA 249 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 297 CEKVYDPVYGSDGKNYDNECELKRA 321 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 36.7 bits (81), Expect = 0.007 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQL 152 C +++C C +E +PVCG++GVTY N C+L Sbjct: 70 CVAAKGKASCECLSECPDHIKPVCGSDGVTYPNHCEL 106 >SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 35.5 bits (78), Expect = 0.016 Identities = 25/61 (40%), Positives = 31/61 (50%), Gaps = 6/61 (9%) Frame = +3 Query: 75 STCICTTEYRPVCGTNGVTYGNRCQLRCA-----KAI-FAYDGPCCGGMRI*GCQTSRIS 236 S+C + VCG +GVTYG+ C+LR A K I AY G C G C T + S Sbjct: 132 SSCNSSPADTEVCGADGVTYGSLCRLRVATCKLGKTIGVAYLGSCKEGS---DCSTVKCS 188 Query: 237 R 239 R Sbjct: 189 R 189 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 35.1 bits (77), Expect = 0.021 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 72 ESTCICTTEYRPVCGTNGVTYGNRCQLR 155 E CT EY PVCG++G TY C ++ Sbjct: 46 ECPMACTREYAPVCGSDGKTYPTECVMQ 73 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 35.1 bits (77), Expect = 0.021 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +3 Query: 54 CCTLGAESTCICTT---EYRPVCGTNGVTYGNRCQLR 155 C ++ ++ C+C + +PVCG+NG Y N C+L+ Sbjct: 194 CMSVRGKAVCMCMSCPKMNKPVCGSNGKDYNNECELQ 230 Score = 32.3 bits (70), Expect = 0.15 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +3 Query: 69 AESTCI-CTTEYRPVCGTNGVTYGNRCQLR 155 A TC+ C PVCG++G Y N C LR Sbjct: 107 AVCTCLSCPNILDPVCGSDGKNYDNECNLR 136 Score = 32.3 bits (70), Expect = 0.15 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +3 Query: 54 CCTLGAESTCICTT---EYRPVCGTNGVTYGNRCQLR 155 C + E+ C C + PVCG++G Y N C+LR Sbjct: 263 CLVVQGEAVCTCLSCPNMLDPVCGSDGKNYDNVCKLR 299 Score = 29.1 bits (62), Expect = 1.4 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 357 CKVQDGKPTCVCVEPCPKILKPVYGSDGKNYDNECLLKLAACKSKSRILIAGSGRYPGPC 416 Query: 192 CG 197 G Sbjct: 417 SG 418 Score = 27.9 bits (59), Expect = 3.2 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 429 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 488 Query: 192 CG 197 G Sbjct: 489 SG 490 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 501 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 540 >SB_12293| Best HMM Match : OATP (HMM E-Value=0) Length = 1446 Score = 35.1 bits (77), Expect = 0.021 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 7/57 (12%) Frame = +3 Query: 21 TSIVLIFLLVACCTLGAESTCIC-------TTEYRPVCGTNGVTYGNRCQLRCAKAI 170 T ++L+ LL G T +C +T+Y PVCG + +TY + C C K I Sbjct: 877 TVLLLMTLLAFSSVTGPNMTTLCNVGCQCSSTDYFPVCGVDKITYFSPCYAGCQKRI 933 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 35.1 bits (77), Expect = 0.021 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAK 164 C +E PVCGT+ TY +RC L+ AK Sbjct: 210 CPSEASPVCGTDMRTYASRCHLQLAK 235 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 35.1 bits (77), Expect = 0.021 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 6/41 (14%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAKA------IFAYDGPC 191 C PVCGT+G TYGN C L A AY G C Sbjct: 28 CPAINDPVCGTDGKTYGNECMLGAATCHSNGTITLAYPGEC 68 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 34.7 bits (76), Expect = 0.028 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C ++PVCGT+G Y NRC LR Sbjct: 737 CQVRFKPVCGTDGREYLNRCFLR 759 Score = 31.1 bits (67), Expect = 0.35 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 42 LLVACCTLGAESTCICTTEYRPVCGTNGVTYGNRCQL 152 +++A T+ + C RP+CG++G Y N+C + Sbjct: 650 VMLANVTMFCNCSRACPITLRPLCGSDGKNYWNKCHI 686 Score = 30.7 bits (66), Expect = 0.46 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 11/53 (20%) Frame = +3 Query: 66 GAESTCICTTE----YRPVCGTNGVTYGNRCQLRCAKAI-------FAYDGPC 191 G + C+C ++ Y PVCG + TY N C R A A F +GPC Sbjct: 245 GGSANCVCPSDCSHTYSPVCGGDKTTYINNC-TRIAAACNMKKDIPFNVNGPC 296 Score = 29.1 bits (62), Expect = 1.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQL 152 C +E PVCG +G TY + C + Sbjct: 807 CPSEASPVCGQDGRTYSSTCAM 828 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 34.3 bits (75), Expect = 0.037 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +3 Query: 51 ACCTLGAESTCICTT---EYRPVCGTNGVTYGNRCQLR 155 +C T + TCIC +PVCGTN TY + C L+ Sbjct: 667 SCTTKDNKPTCICPECPQVDKPVCGTNNKTYTSECALQ 704 Score = 33.9 bits (74), Expect = 0.049 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCAKAI 170 C + PVCG++ VTY + CQLR A + Sbjct: 222 CKDKSDPVCGSDNVTYASECQLRRAACL 249 Score = 33.5 bits (73), Expect = 0.065 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 54 CCTLGAESTCICTTEY------RPVCGTNGVTYGNRCQLR 155 C L C C + +P+CG+N TY N C+LR Sbjct: 278 CVALNGRPACSCPSSCGDESLPQPICGSNNKTYANECELR 317 Score = 32.7 bits (71), Expect = 0.11 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 CT E +P+C ++G TY N C ++ Sbjct: 2158 CTNETKPICASDGQTYDNECLMQ 2180 Score = 31.1 bits (67), Expect = 0.35 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C++ PVCGT+ TY N C +R Sbjct: 1139 CSSTVDPVCGTDNNTYDNECLMR 1161 Score = 30.7 bits (66), Expect = 0.46 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 69 AESTC--ICTTEYRPVCGTNGVTYGNRCQLR 155 AE C +C VCGT+ +TY N C L+ Sbjct: 1440 AECVCSKVCPRSLDLVCGTDNITYNNECFLK 1470 Score = 30.7 bits (66), Expect = 0.46 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +3 Query: 54 CCTLGAESTCICTTEYRP----VCGTNGVTYGNRC 146 C +G C+C +P VCG++GVTY + C Sbjct: 2614 CKVVGDMPQCVCPPACKPTLTPVCGSDGVTYESEC 2648 Score = 30.3 bits (65), Expect = 0.60 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C + VCG++G TY N C LR A Sbjct: 1653 CPKIVKQVCGSDGKTYDNECVLRMA 1677 Score = 30.3 bits (65), Expect = 0.60 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C E VCGTN TY N C +R Sbjct: 1794 CPKEDAEVCGTNWKTYTNECMMR 1816 Score = 29.9 bits (64), Expect = 0.80 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C+ PVCG++ TY N C++R Sbjct: 612 CSKREDPVCGSDSKTYPNECRMR 634 Score = 29.9 bits (64), Expect = 0.80 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 9/67 (13%) Frame = +3 Query: 51 ACCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLR---CA--KAIFAYDGPCCGGM 203 +C ++TC C+ + +PVCG++ Y N C ++ CA K I A+ C Sbjct: 1361 SCQAKDGKATCECSEDCPKTLKPVCGSDNNDYDNECLMQARACATNKTITAHRNGYCDPC 1420 Query: 204 RI*GCQT 224 + C T Sbjct: 1421 KNHSCST 1427 Score = 29.5 bits (63), Expect = 1.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C++ PVCG++ TY N C +R Sbjct: 1210 CSSTVDPVCGSDNNTYDNECLMR 1232 Score = 27.9 bits (59), Expect = 3.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C VCGT+ +TY N C ++ Sbjct: 1513 CPASLDLVCGTDNITYSNECLMK 1535 Score = 27.9 bits (59), Expect = 3.2 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLR 155 C + TC+C PVCG++ +Y N C LR Sbjct: 1709 CTIINGSPTCVCPPSCPNTLDPVCGSDLQSYDNVCFLR 1746 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV GT+ Y N C L+ A Sbjct: 1053 CKAQDDQPTCVCVEPCPKTLKPVYGTDNKNYDNECLLKLA 1092 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV GT+ Y N C L+ A Sbjct: 1266 CKAQDDQPTCVCVEPCPKTLKPVYGTDNKNYDNECLLKLA 1305 Score = 26.6 bits (56), Expect = 7.4 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +3 Query: 84 ICTTEYRPVCGTNGVTYGNRC---QLRCAKA 167 IC PVC ++ TY N C QL C A Sbjct: 1583 ICPITLDPVCASDNNTYPNECAMKQLACQSA 1613 >SB_29074| Best HMM Match : Kazal_2 (HMM E-Value=3.3e-16) Length = 711 Score = 33.5 bits (73), Expect = 0.065 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 108 VCGTNGVTYGNRCQLRCAKAIFAYDGPC 191 VCG +GV+Y + C + FAY GPC Sbjct: 405 VCGEDGVSYPSECGMIKHSVTFAYRGPC 432 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 32.7 bits (71), Expect = 0.11 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 4/29 (13%) Frame = +3 Query: 78 TCIC----TTEYRPVCGTNGVTYGNRCQL 152 TC C T +Y PVCG++G TY NR + Sbjct: 7 TCQCPMAVTADYNPVCGSDGRTYPNRASM 35 >SB_57638| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-11) Length = 502 Score = 31.9 bits (69), Expect = 0.20 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = +3 Query: 51 ACCTLGAEST-CICTTEYR---PVCGTNGVTYGNRCQLR 155 A C +G+++ C C E PVC +G+ YGN C++R Sbjct: 395 AKCKVGSKAVGCSCAMECPEGVPVCADDGLIYGNLCKMR 433 >SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1338 Score = 31.9 bits (69), Expect = 0.20 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = +3 Query: 42 LLVACCTLGAESTC----ICTTEYRPVCG-TNGVTYGNRCQLR 155 L C + E+ C +C + PVCG TNG Y +RC LR Sbjct: 1075 LYETCTMINNEAICECPRMCKDKGEPVCGLTNGKEYKSRCHLR 1117 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 31.1 bits (67), Expect = 0.35 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C++ PVCGT+ TY N C +R Sbjct: 165 CSSTVDPVCGTDNNTYDNECLMR 187 Score = 29.5 bits (63), Expect = 1.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C++ PVCG++ TY N C +R Sbjct: 279 CSSTVDPVCGSDNNTYDNECLMR 301 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV GT+ Y N C L+ A Sbjct: 79 CKAQDDQPTCVCVEPCPKTLKPVYGTDNKNYDNECLLKLA 118 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 31.1 bits (67), Expect = 0.35 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C++ PVCGT+ TY N C +R Sbjct: 31 CSSTVDPVCGTDNNTYDNECLMR 53 Score = 26.6 bits (56), Expect = 7.4 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV GT+ Y N C L+ A Sbjct: 87 CKAQDDKPTCVCVEPCPKTLKPVYGTDNKNYDNECLLKLA 126 >SB_27078| Best HMM Match : Kazal_2 (HMM E-Value=7.6e-07) Length = 54 Score = 29.9 bits (64), Expect = 0.80 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 105 PVCGTNGVTYGNRCQLR 155 PVCGT+G Y +RC+LR Sbjct: 13 PVCGTDGNDYPSRCKLR 29 >SB_56344| Best HMM Match : Kazal_2 (HMM E-Value=1.5e-09) Length = 217 Score = 29.9 bits (64), Expect = 0.80 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQL 152 C Y PVC G+ + N+C+L Sbjct: 41 CPNTYEPVCSVYGIQFPNKCEL 62 >SB_45072| Best HMM Match : Kazal_2 (HMM E-Value=5.8e-06) Length = 361 Score = 29.9 bits (64), Expect = 0.80 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 81 CICT-TEYRPVCGTNGVTYGNRCQLRC 158 C C +++ PVCG + VTY C C Sbjct: 135 CACVKSQFNPVCGADDVTYFTPCHAGC 161 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 29.5 bits (63), Expect = 1.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C++ PVCG++ TY N C +R Sbjct: 3 CSSTVDPVCGSDNNTYDNECLMR 25 >SB_5272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 64 CEKVYDPVYGSDGKNYDNECELKRA 88 >SB_33373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 32 CEKVYDPVYGSDGKNYDNECELKRA 56 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 151 CEKVYDPVYGSDGKNYDNECELKRA 175 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 223 CEKVYDPVYGSDGKNYDNECELKRA 247 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 524 CEKVYDPVYGSDGKNYDNECELKRA 548 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 596 CEKVYDPVYGSDGKNYDNECELKRA 620 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA 161 C Y PV G++G Y N C+L+ A Sbjct: 678 CEKVYDPVYGSDGKNYDNECELKRA 702 >SB_5367| Best HMM Match : wnt (HMM E-Value=0) Length = 367 Score = 28.7 bits (61), Expect = 1.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 21 TSIVLIFLLVACCTLGAESTCICTTEYRPV 110 +S +++ L CT G STC C+ E RP+ Sbjct: 118 SSAGVVWALARACTEGNLSTCSCSRERRPL 147 >SB_37368| Best HMM Match : Kazal_1 (HMM E-Value=9.2e-09) Length = 68 Score = 28.3 bits (60), Expect = 2.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 105 PVCGTNGVTYGNRCQL 152 PVCG++ VTY N C L Sbjct: 20 PVCGSDDVTYANACTL 35 >SB_44627| Best HMM Match : Kazal_1 (HMM E-Value=3.19496e-43) Length = 260 Score = 27.9 bits (59), Expect = 3.2 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ A + + A Y GPC Sbjct: 60 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPC 119 Query: 192 CG 197 G Sbjct: 120 SG 121 Score = 27.1 bits (57), Expect = 5.6 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 14/62 (22%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLR---C---AKAIFA----YDGPC 191 C + TC+C +PV G++G Y N C L+ C ++ + A Y GPC Sbjct: 132 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLSACKSKSRILIAGFGRYPGPC 191 Query: 192 CG 197 G Sbjct: 192 SG 193 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 204 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 243 Score = 26.2 bits (55), Expect = 9.8 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 10/47 (21%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLRCA------KAIFA----YDGPCCG 197 C +PV G++G Y N C L+ A + + A Y GPC G Sbjct: 3 CPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGRYPGPCSG 49 >SB_47527| Best HMM Match : Alpha_E2_glycop (HMM E-Value=2.4) Length = 429 Score = 27.5 bits (58), Expect = 4.3 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -2 Query: 272 DILN*AKIRDVPGNTRRLAALNSHATAAR 186 D++N + D P RRL+AL SHA +R Sbjct: 264 DVINDVRGIDAPHLVRRLSALGSHAGLSR 292 >SB_43077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C + VC TNG T+ N C+L+ Sbjct: 330 CPSYVDQVCATNGETFDNLCRLK 352 >SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) Length = 1042 Score = 27.5 bits (58), Expect = 4.3 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 10/52 (19%) Frame = +3 Query: 72 ESTCICTTE----YRPVCGTNGVTYGNRCQLR---C-AKAIFAY--DGPCCG 197 ++ C+C ++ VCGTNG T+ N C + C K F+Y G C G Sbjct: 210 DAQCVCPSKCPAYIDQVCGTNGQTFDNLCLFKKHVCRIKGNFSYLHHGSCRG 261 >SB_7030| Best HMM Match : Kazal_2 (HMM E-Value=4.6e-08) Length = 286 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C + VC TNG T+ N C+L+ Sbjct: 64 CPSYVDQVCATNGETFDNLCRLK 86 >SB_59417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 6/49 (12%) Frame = +3 Query: 75 STCICTTEYRPVCGTNGVTYGNRCQLRCAKAIFA------YDGPCCGGM 203 STC +C ++G+TY ++C+L + Y G C GM Sbjct: 51 STCSPAQPSDRLCASDGITYNSKCELNKTACLLGSSITVLYRGACDKGM 99 >SB_16978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 75 STCICTTE-YRPVCGTNGVTYGNRCQLRC 158 + C C+ + Y P+CG G+ Y + C C Sbjct: 642 AACNCSVDKYSPLCGPGGLNYFSPCFAGC 670 >SB_25971| Best HMM Match : Sushi (HMM E-Value=0.54) Length = 275 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 63 LGAESTCICTTEYRPVCG-TNGVTYGNRCQLR 155 + AE TC C Y+PV G+++G+R LR Sbjct: 85 ISAEVTCQCQAGYQPVSRLCEGLSHGSRYVLR 116 >SB_25348| Best HMM Match : Kazal_1 (HMM E-Value=5.3e-09) Length = 73 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 17 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 56 >SB_14008| Best HMM Match : Kazal_1 (HMM E-Value=5.3e-09) Length = 73 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 54 CCTLGAESTCICTTE----YRPVCGTNGVTYGNRCQLRCA 161 C + TC+C +PV G++G Y N C L+ A Sbjct: 17 CKVQDDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLA 56 >SB_9401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 26.6 bits (56), Expect = 7.4 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -2 Query: 215 ALNSHATAARPVVGKYGFRTSQLAPVAVSNTVSTTNRPI 99 A+ +A A PV+GK+ +T+ + P V+ ++ + I Sbjct: 193 AVEGYAEAMAPVLGKFNIKTTIIEPGPVATNFASNAKAI 231 >SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 26.6 bits (56), Expect = 7.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 84 ICTTEYRPVCGTNGVTYGNRCQL 152 +C+ +Y P+C Y NRC+L Sbjct: 1119 LCSDKYEPLCSVYLEEYINRCEL 1141 >SB_51362| Best HMM Match : Disintegrin (HMM E-Value=4.4) Length = 136 Score = 26.6 bits (56), Expect = 7.4 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = +3 Query: 12 TMKTSIVLIFLLVACCTLGAESTC------ICTTEYRPVCGTNGVTY 134 T+KT + F+ V CTL E TC CT + + C V Y Sbjct: 37 TLKTKHICDFVSVLYCTLKTEHTCDFVSVLYCTLKAKHTCDFVSVLY 83 >SB_49500| Best HMM Match : Collagen (HMM E-Value=1.8e-07) Length = 621 Score = 26.6 bits (56), Expect = 7.4 Identities = 13/64 (20%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = -1 Query: 231 YETSGSPKFACHRSTARRRQIWLSHISVGTCCRK*HR*YHKQAYI-RWCKYRYFQPPKCS 55 +E +P C + T +Q + + + C++ Y ++ +W Y++ P C+ Sbjct: 311 HEPQHTPAMRCEQQTPGYQQPLVGNSTALNACKEHCEAYSFPVFVLKWSGCEYYKNPHCA 370 Query: 54 RRRG 43 RG Sbjct: 371 LLRG 374 >SB_40708| Best HMM Match : SRCR (HMM E-Value=0) Length = 1976 Score = 26.6 bits (56), Expect = 7.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 78 TCICTTEYRPVCGTNGVTYGNRCQLRC 158 TC T + CG+N V N+CQ C Sbjct: 1200 TCSGTADNCTGCGSNQVLNNNKCQKTC 1226 >SB_38490| Best HMM Match : Neur_chan_LBD (HMM E-Value=2e-24) Length = 478 Score = 26.6 bits (56), Expect = 7.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -2 Query: 203 HATAARPVVGKYGFRTSQLAPVAVSNTVSTTNRPIFGGANT 81 H PVV +G + ++A V N + N FGG NT Sbjct: 56 HPGGNNPVVVTFGAKLGRIAAVKWVNPSLSWNASEFGGVNT 96 >SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1577 Score = 26.6 bits (56), Expect = 7.4 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -1 Query: 228 ETSGSPKFACHRSTARRRQIWLSHISVGTCCRK*HR*YHKQAYIRWCK 85 +TSGS F R++I + + C RK HR Y ++ CK Sbjct: 332 QTSGSALFVEANGQGERKKILVKYARCFRCLRKNHRSYECKSKDSNCK 379 >SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) Length = 465 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 112 PAMGDHGCVEIQTLVTPKLARPIRRKI 138 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 410 PAMGDHGCVEIQTLVTPKLARPIRRKI 436 >SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 696 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 414 PAMGDHGCVEIQTLVTPKLARPIRRKI 440 >SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 822 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 414 PAMGDHGCVEIQTLVTPKLARPIRRKI 440 >SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) Length = 547 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 154 PAMGDHGCVEIQTLVTPKLARPIRRKI 180 >SB_9563| Best HMM Match : Kazal_1 (HMM E-Value=1.7e-07) Length = 170 Score = 26.2 bits (55), Expect = 9.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 87 CTTEYRPVCGTNGVTYGNRCQLR 155 C + VC TNG T+ N C L+ Sbjct: 107 CPSYVDQVCATNGETFDNLCLLK 129 >SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) Length = 723 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 39 PAMGDHGCVEIQTLVTPKLARPIRRKI 65 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 396 PAMGDHGCVEIQTLVTPKLARPIRRKI 422 >SB_52825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 26.2 bits (55), Expect = 9.8 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = -2 Query: 227 RRLAALNSHATAARPVVGKYGFRTSQLAPVAVSNTVSTT----NRPIFGGANT 81 RR A A P V K+ RTS LA VAV+ V+TT N P+ G +++ Sbjct: 403 RRQARAKLEAEGKIPKVRKHR-RTSALASVAVTLRVTTTPAALNAPLQGASHS 454 >SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1080 Score = 26.2 bits (55), Expect = 9.8 Identities = 8/36 (22%), Positives = 18/36 (50%) Frame = +3 Query: 72 ESTCICTTEYRPVCGTNGVTYGNRCQLRCAKAIFAY 179 E + +C++E+ PVC + + C++ F + Sbjct: 623 ECSAVCSSEHAPVCSVFYTDHASECEMHKQACDFGF 658 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 1561 PAMGDHGCVEIQTLVTPKLARPIRRKI 1587 >SB_37964| Best HMM Match : Bowman-Birk_leg (HMM E-Value=4.5) Length = 506 Score = 26.2 bits (55), Expect = 9.8 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = +3 Query: 45 LVAC--CTLGAESTCICTTEYRPVCGTN---GVTYGNRCQLRCA 161 + AC C L C+C +E+R V N G +GN+ L A Sbjct: 57 IAACKSCALTRYKKCLCNSEWRLVYENNPSGGAVHGNKYALLAA 100 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 482 PAMGDHGCVEIQTLVTPKLARPIRRKI 508 >SB_31752| Best HMM Match : Bac_surface_Ag (HMM E-Value=0.0069) Length = 354 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 117 TNG-VTYGNRCQLRCAKAIFAYD 182 T+G + GN QL C+K +F YD Sbjct: 249 THGFINAGNLTQLNCSKLLFVYD 271 >SB_27602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 26.2 bits (55), Expect = 9.8 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -1 Query: 333 IKTKTIVIEQFEYGTESVPPRHFKLSQNTGRPGKYETSGSPKFACHRSTARRR 175 +KT +IE+FE +V FK+ +N G G G + +R+T + R Sbjct: 31 LKTAEKLIEEFET-RHTVKFSSFKVDKNVGNGGFSPKMGDIRSHMYRATVKNR 82 >SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) Length = 832 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 154 PAMGDHGCVEIQTLVTPKLARPIRRKI 180 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 393 PAMGDHGCVEIQTLVTPKLARPIRRKI 419 >SB_12693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0014) Length = 413 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 115 PQTGLYSVVQIQVLSAPKVQQATRRKI 35 P G + V+IQ L PK+ + RRKI Sbjct: 330 PAMGDHGCVEIQTLVTPKLARPIRRKI 356 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,232,823 Number of Sequences: 59808 Number of extensions: 288428 Number of successful extensions: 972 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -