BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0972.Seq (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 25 1.3 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 3.1 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 3.1 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 4.1 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 23 4.1 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 5.4 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 22 7.2 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 22 7.2 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 22 9.5 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 22 9.5 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 22 9.5 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 22 9.5 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 22 9.5 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 24.6 bits (51), Expect = 1.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 173 KYGFRTSQLAPVAVSNTVSTTN 108 K G R SQL V + N + TTN Sbjct: 52 KMGLRLSQLIDVNLKNQIMTTN 73 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.4 bits (48), Expect = 3.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 203 ANLGLPDVSYFPGRPVFWLSL 265 A LGL D Y G+ V WL+L Sbjct: 160 AALGLSDTFYLIGQFVAWLNL 180 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.4 bits (48), Expect = 3.1 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = -2 Query: 188 RPVVGKYGFRTSQLAPVAVSNTVSTTNRPIFGGANTGTFSPQSAAGDEEEN 36 RPV G + P+ V VS + + + F P D+EE+ Sbjct: 41 RPVTFPNGEASPTRVPLGVDGVVSGDGSSVHDRSRSERFGPPYDGDDDEED 91 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.0 bits (47), Expect = 4.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 228 ETSGSPKFACHRSTARRRQI 169 E P +C RS ARRR+I Sbjct: 3 ELKRKPTSSCSRSPARRRRI 22 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 23.0 bits (47), Expect = 4.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 167 GFRTSQLAPVAVSNTVSTTN 108 G + SQL V++ N V TTN Sbjct: 60 GLKLSQLIEVSLRNQVMTTN 79 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 22.6 bits (46), Expect = 5.4 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -2 Query: 245 DVPGNTRRLAALNSHATAARPVVGKYGFRTSQLAPVAVSNTVSTTN 108 D+ N RL S+ T V+ K G R SQL + + + + TTN Sbjct: 42 DLLSNYNRLIRPVSNNTDT--VLVKLGLRLSQLIDLNLKDQILTTN 85 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 22.2 bits (45), Expect = 7.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +3 Query: 3 KSKTMKTSIVLIFLLVACCT 62 K KT++ +I+++ + V C T Sbjct: 263 KRKTLRMTIMIVIVFVVCWT 282 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 22.2 bits (45), Expect = 7.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +3 Query: 3 KSKTMKTSIVLIFLLVACCT 62 K KT++ +I+++ + V C T Sbjct: 263 KRKTLRMTIMIVIVFVVCWT 282 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 21.8 bits (44), Expect = 9.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 96 RWCKYRYFQPPKC 58 R+CKYR Q KC Sbjct: 58 RYCKYRACQCEKC 70 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 21.8 bits (44), Expect = 9.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 96 RWCKYRYFQPPKC 58 R+CKYR Q KC Sbjct: 58 RYCKYRACQCEKC 70 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 21.8 bits (44), Expect = 9.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 200 ATAARPVVGKYGFRTSQLAPVAVSNTVSTTN 108 A + P+ K+G Q+ V N + TTN Sbjct: 43 ANESDPLEVKFGLTLQQIIDVDEKNQILTTN 73 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 21.8 bits (44), Expect = 9.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 203 ANLGLPDVSYFPGRPVFWLS 262 A LG+ D Y G V WLS Sbjct: 79 AALGISDTCYLVGLFVTWLS 98 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 21.8 bits (44), Expect = 9.5 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = -2 Query: 209 NSHATAARPVVGKYGF---RT--SQLAPVAVSNTVSTTNRPIFGGANTGTFSPQSAAGDE 45 +S A AA VG++ RT S L+P + S + S+ + + SP+S+A D+ Sbjct: 40 SSSAAAAVVSVGEFTLGPGRTYASALSPSSSSASPSSPSSVASPNSRASNMSPESSASDQ 99 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 447,128 Number of Sequences: 2352 Number of extensions: 9251 Number of successful extensions: 16 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -