BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0971.Seq (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0083 - 566201-567127,567223-567464,567623-567880,568173-56... 28 3.6 02_04_0276 + 21491150-21492761,21492891-21492947,21493817-214938... 27 8.4 >02_01_0083 - 566201-567127,567223-567464,567623-567880,568173-568298, 568420-568489 Length = 540 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 211 ARICSLWSPESREALNNVTLLVAFXIXNARRDVEA 107 AR C W PESR ++ V ++A ++R+ A Sbjct: 449 ARECLQWEPESRPTMSEVVQILATIAPSSRKHAAA 483 >02_04_0276 + 21491150-21492761,21492891-21492947,21493817-21493870, 21493994-21494022 Length = 583 Score = 27.1 bits (57), Expect = 8.4 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = -3 Query: 317 RTFGSCTRPSGRWCEATIRGIXLNASKAEAS--LAESGKDMLTVEPRESG--GSKQCD 156 R GS RP C A I+ + + AEA LA G D++ +G G+ Q D Sbjct: 86 RLVGSARRPDAGTCAALIKKLSASGRTAEARRVLAACGPDVMAYNAMVAGYCGAGQLD 143 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,882,288 Number of Sequences: 37544 Number of extensions: 206748 Number of successful extensions: 426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -