BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0970.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 64 7e-11 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 64 7e-11 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 64 7e-11 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 9e-10 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 58 5e-09 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 58 5e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 54 1e-07 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 52 3e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 51 5e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 48 5e-06 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 43 1e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 38 0.005 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.005 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 38 0.005 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.005 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.005 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 38 0.005 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 38 0.005 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.005 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 37 0.009 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 37 0.012 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 37 0.012 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 37 0.012 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 37 0.012 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 37 0.012 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 37 0.012 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 37 0.012 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 37 0.012 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 37 0.012 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 37 0.012 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 37 0.012 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 37 0.012 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 37 0.012 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 37 0.012 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 36 0.022 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 36 0.022 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 36 0.022 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_54293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 36 0.022 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 36 0.022 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 36 0.022 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 36 0.022 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 36 0.029 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 35 0.050 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 35 0.050 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 35 0.050 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 35 0.050 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 35 0.050 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 35 0.050 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 35 0.050 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 35 0.050 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 35 0.050 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 35 0.050 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 35 0.050 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 35 0.050 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 35 0.050 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 35 0.050 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 35 0.050 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 35 0.050 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 35 0.050 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 35 0.050 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 35 0.050 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 35 0.050 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 35 0.050 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 35 0.050 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 35 0.050 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 35 0.050 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 35 0.050 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 35 0.050 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 35 0.050 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 35 0.050 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 35 0.050 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 35 0.050 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 35 0.050 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 35 0.050 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 35 0.050 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 35 0.050 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 35 0.050 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 35 0.050 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 35 0.050 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 35 0.050 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 35 0.050 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 35 0.050 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 35 0.050 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 35 0.050 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 35 0.050 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 35 0.050 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 35 0.050 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 35 0.050 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 35 0.050 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 35 0.050 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 35 0.050 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 35 0.050 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.5 bits (160), Expect = 3e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 548 RLSWERQGFPSHDLVKRRPVNCNTTHYRANW 456 RLSW GFPSHD+VKRRPVNCNTTHYRANW Sbjct: 50 RLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 64.9 bits (151), Expect = 4e-11 Identities = 27/32 (84%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = -1 Query: 548 RLSWE-RQGFPSHDLVKRRPVNCNTTHYRANW 456 R WE R GFPSHD+VKRRPVNCNTTHYRANW Sbjct: 49 RNCWEGRSGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 31.1 bits (67), Expect = 0.62 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +3 Query: 408 DIKLIDTVDLEGGP 449 +IKLIDTVDLEGGP Sbjct: 219 NIKLIDTVDLEGGP 232 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 64.9 bits (151), Expect = 4e-11 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 536 ERQGFPSHDLVKRRPVNCNTTHYRANW 456 +RQGFPSHD+VKRRPVNCNTTHYRANW Sbjct: 76 KRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 64.1 bits (149), Expect = 7e-11 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 548 RLSWERQGFPSHDLVKRRPVNCNTTHYRANW 456 RLSW GFPSHD+VKRRPVNCNTTHYRANW Sbjct: 621 RLSW---GFPSHDVVKRRPVNCNTTHYRANW 648 Score = 32.7 bits (71), Expect = 0.20 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 411 IKLIDTVDLEGGPRYPIRPIVSRIT 485 IKLIDTVDLEGGP + R+T Sbjct: 550 IKLIDTVDLEGGPALASVAVTLRVT 574 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 64.1 bits (149), Expect = 7e-11 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 548 RLSWERQGFPSHDLVKRRPVNCNTTHYRANW 456 RLSW GFPSHD+VKRRPVNCNTTHYRANW Sbjct: 64 RLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 64.1 bits (149), Expect = 7e-11 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 548 RLSWERQGFPSHDLVKRRPVNCNTTHYRANW 456 RLSW GFPSHD+VKRRPVNCNTTHYRANW Sbjct: 64 RLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 60.9 bits (141), Expect = 7e-10 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -1 Query: 530 QGFPSHDLVKRRPVNCNTTHYRANW 456 +GFPSHD+VKRRPVNCNTTHYRANW Sbjct: 35 KGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 60.5 bits (140), Expect = 9e-10 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -1 Query: 527 GFPSHDLVKRRPVNCNTTHYRANW 456 GFPSHD+VKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 58.0 bits (134), Expect = 5e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 524 FPSHDLVKRRPVNCNTTHYRANW 456 FPSHD+VKRRPVNCNTTHYRANW Sbjct: 39 FPSHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 58.0 bits (134), Expect = 5e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 524 FPSHDLVKRRPVNCNTTHYRANW 456 FPSHD+VKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 58.0 bits (134), Expect = 5e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 524 FPSHDLVKRRPVNCNTTHYRANW 456 FPSHD+VKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 58.0 bits (134), Expect = 5e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 524 FPSHDLVKRRPVNCNTTHYRANW 456 FPSHD+VKRRPVNCNTTHYRANW Sbjct: 31 FPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 58.0 bits (134), Expect = 5e-09 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 524 FPSHDLVKRRPVNCNTTHYRANW 456 FPSHD+VKRRPVNCNTTHYRANW Sbjct: 45 FPSHDVVKRRPVNCNTTHYRANW 67 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 53.6 bits (123), Expect = 1e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +3 Query: 456 PIRPIVSRITIHWPSFYKVVTGKTLAF 536 PIRPIVSRITIHWP+FY TGKTLA+ Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLAY 65 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 53.2 bits (122), Expect = 1e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +3 Query: 459 IRPIVSRITIHWPSFYKVVTGKTLAFP 539 +RP+VSRITIHW SFY VVTGKTLA P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALP 59 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 530 QGFPSHDLVKRRPVNCNTTHYRAN 459 +GFPSHD KRRPVNCNTTHYRAN Sbjct: 74 RGFPSHDGEKRRPVNCNTTHYRAN 97 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 116 QEFDIKLIDTVDLEGGP 132 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 51.2 bits (117), Expect = 5e-07 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -1 Query: 515 HDLVKRRPVNCNTTHYRANW 456 HD+VKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 51.2 bits (117), Expect = 5e-07 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -1 Query: 515 HDLVKRRPVNCNTTHYRANW 456 HD+VKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 Score = 31.5 bits (68), Expect = 0.47 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +3 Query: 408 DIKLIDTVDLEGGP 449 +IKLIDTVDLEGGP Sbjct: 86 EIKLIDTVDLEGGP 99 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 50.8 bits (116), Expect = 7e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +3 Query: 465 PIVSRITIHWPSFYKVVTGKTLAFP 539 P +SRITIHWPSFY VVTGKTLA P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALP 101 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -1 Query: 524 FPSHDLVKRRPVNCNTTHYRAN 459 F SHD+VKRRPVNCNTTHYRAN Sbjct: 19 FRSHDVVKRRPVNCNTTHYRAN 40 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGKTLAFP 539 SRITIHWPSFY VVTGKTLA P Sbjct: 2 SRITIHWPSFYNVVTGKTLALP 23 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGKTLAFP 539 SRITIHWPSFY VVTGKTLA P Sbjct: 2 SRITIHWPSFYNVVTGKTLALP 23 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGKTLAFP 539 SRITIHWPSFY VVTGKTLA P Sbjct: 2 SRITIHWPSFYNVVTGKTLALP 23 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGKTLAFP 539 SRITIHWPSFY VVTGKTLA P Sbjct: 2 SRITIHWPSFYNVVTGKTLALP 23 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGKTLAFP 539 SRITIHWPSFY VVTGKTLA P Sbjct: 2 SRITIHWPSFYNVVTGKTLALP 23 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGKTLAFP 539 SRITIHWPSFY VVTGKTLA P Sbjct: 2 SRITIHWPSFYNVVTGKTLALP 23 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 44.0 bits (99), Expect = 8e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGKTLA 533 SRITIHWPSFY VVTGKTL+ Sbjct: 2 SRITIHWPSFYNVVTGKTLS 21 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 43.2 bits (97), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 456 PIRPIVSRITIHWPSFYKVVT 518 PIRPIVS ITIHWPSFY VT Sbjct: 41 PIRPIVSHITIHWPSFYNGVT 61 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 7 GPPLEVDGIDKLDIEF 22 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.9 bits (94), Expect = 3e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 459 IRPIVSRITIHWPSFYK 509 IRPIVSRITIHWPSFYK Sbjct: 18 IRPIVSRITIHWPSFYK 34 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/24 (79%), Positives = 21/24 (87%), Gaps = 1/24 (4%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP-RYPIRP 467 +EFDIKLIDTVDLEGGP R P+ P Sbjct: 21 QEFDIKLIDTVDLEGGPVRKPVVP 44 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGPRY 455 +EFDIKLIDTVDLEGGP Y Sbjct: 67 QEFDIKLIDTVDLEGGPAY 85 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGK 524 SRITIHWPSFY VVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGK 524 SRITIHWPSFY VVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGK 524 SRITIHWPSFY VVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGK 524 SRITIHWPSFY VVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGPRY 455 +EFDIKLIDTVDLEGG RY Sbjct: 21 QEFDIKLIDTVDLEGGARY 39 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 489 HWPSFYKVVTGKTLAFP 539 HWPSFY VVTGKTLA P Sbjct: 62 HWPSFYNVVTGKTLALP 78 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 489 HWPSFYKVVTGKTLAFP 539 HWPSFY VVTGKTLA P Sbjct: 5 HWPSFYNVVTGKTLALP 21 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 489 HWPSFYKVVTGKTLAFP 539 HWPSFY VVTGKTLA P Sbjct: 57 HWPSFYNVVTGKTLALP 73 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -1 Query: 452 PGPPLXVDGIDKLDIEF 402 PGPPL VDGIDKLDIEF Sbjct: 19 PGPPLEVDGIDKLDIEF 35 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAV LQ DWENPGV L Sbjct: 65 LAVDLQRPDWENPGVTQL 82 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +3 Query: 381 NGINSGREFDIKLIDTVDLEGGP 449 +G +EFDIKLIDTVDLEGGP Sbjct: 15 SGSPGQQEFDIKLIDTVDLEGGP 37 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 37.1 bits (82), Expect = 0.009 Identities = 24/54 (44%), Positives = 29/54 (53%) Frame = +2 Query: 383 RNK*RPRIRYQAYRYRRPXGGAPVXXXXXXXXXXXXLAVVLQGRDWENPGVPNL 544 R + R R+RY+ R R+ G P+ LAVVLQ RDWENPGV L Sbjct: 115 RQRLRVRLRYRICRERQ---GDPLESTCRHASLA--LAVVLQRRDWENPGVTQL 163 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 253 TPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 921 TPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 33 TPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 408 TPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 257 TPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 324 TPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 390 TPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 82 TPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 64 TPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 300 TPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 284 TPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 273 TPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 298 TPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 482 TPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 151 TPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 317 TPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 167 TPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 360 TPGFSQSRRCKTTASEL 376 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 41 TPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 27 TPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 226 TPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 618 TPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 254 TPGFSQSRRCKTTASEL 270 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 63 TPGFSQSRRCKTTASEL 79 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 94 TPGFSQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 532 TPGFSQSRRCKTTASEL 548 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 34 TPGFSQSRRCKTTASEL 50 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 115 TPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 423 TPGFSQSRRCKTTASEL 439 Score = 30.7 bits (66), Expect = 0.82 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 411 IKLIDTVDLEGGP 449 IKLIDTVDLEGGP Sbjct: 323 IKLIDTVDLEGGP 335 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 27 TPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL 484 TPGFSQSR CKTTASEL Sbjct: 216 TPGFSQSRRCKTTASEL 232 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +3 Query: 489 HWPSFYKVVTGKTLAFP 539 HWPSFY VTGKTLA P Sbjct: 5 HWPSFYNDVTGKTLALP 21 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 455 VPGPPLXVDGIDKLDIEF 402 V GPPL VDGIDKLDIEF Sbjct: 19 VLGPPLEVDGIDKLDIEF 36 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 66 LAVVLQRRDWENPGVTQL 83 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 31.9 bits (69), Expect = 0.36 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ DWENPGV L Sbjct: 65 LAVVLQRLDWENPGVTQL 82 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 25 GPPLEVDGIDKLDIEF 40 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 50 GPPLEVDGIDKLDIEF 65 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 95 LAVVLQRRDWENPGVTQL 112 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +2 Query: 440 GGAPVXXXXXXXXXXXXLAVVLQGRDWENPGVPNL 544 GGAP+ LAV LQ DW+NPGV L Sbjct: 51 GGAPIRPYSESYYSS--LAVGLQRLDWKNPGVTPL 83 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 22 GPPLEVDGIDKLDIEF 37 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 67 LAVVLQRRDWENPGVTQL 84 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 7 GPPLEVDGIDKLDIEF 22 Score = 31.9 bits (69), Expect = 0.36 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LA VLQ RDWENPGV L Sbjct: 52 LAGVLQRRDWENPGVTQL 69 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.9 bits (79), Expect = 0.022 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 534 TPGFSQSRPCKTTASEL*YDSL 469 TPGFSQSR CKTTASE D L Sbjct: 41 TPGFSQSRRCKTTASEFPGDPL 62 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 85 LAVVLQRRDWENPGVTQL 102 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAV LQ RDWENPGV L Sbjct: 65 LAVFLQRRDWENPGVTQL 82 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 31.9 bits (69), Expect = 0.36 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ DWENPGV L Sbjct: 65 LAVVLQRLDWENPGVTQL 82 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_54293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 395 RPRIRYQAYRYRRPXGGA 448 RPR YQAYRYRRP GGA Sbjct: 91 RPRRDYQAYRYRRPRGGA 108 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 21 GPPLEVDGIDKLDIEF 36 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 66 LAVVLQRRDWENPGVTQL 83 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 31.9 bits (69), Expect = 0.36 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ DWENPGV L Sbjct: 65 LAVVLQRPDWENPGVTQL 82 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 25 GPPLEVDGIDKLDIEF 40 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 35.9 bits (79), Expect = 0.022 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +3 Query: 375 YVNGINSGREFDIKLIDTVDLEGGP 449 Y + + S ++ DIKLIDTVDLEGGP Sbjct: 66 YGSTLKSRQKTDIKLIDTVDLEGGP 90 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ DWENPGV L Sbjct: 65 LAVVLQRHDWENPGVTQL 82 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 9 GPPLEVDGIDKLDIEF 24 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 31.9 bits (69), Expect = 0.36 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LA VLQ RDWENPGV L Sbjct: 65 LAGVLQRRDWENPGVTQL 82 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 58 GPPLEVDGIDKLDIEF 73 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 103 LAVVLQRRDWENPGVTQL 120 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 474 SRITIHWPSFYKVVTGKT 527 SRITIHWPSFY V+ KT Sbjct: 2 SRITIHWPSFYNVMLAKT 19 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 35.9 bits (79), Expect = 0.022 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEFAAAIYSVDINSYE 363 GPPL VDGIDKLD F AI+ + + E Sbjct: 20 GPPLEVDGIDKLDAVFLTAIWETLVKNAE 48 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 94 LAVVLQRRDWENPGVTQL 111 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.9 bits (79), Expect = 0.022 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 390 NSGREFDIKLIDTVDLEGGP 449 N R+ DIKLIDTVDLEGGP Sbjct: 6 NPVRKVDIKLIDTVDLEGGP 25 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEF 402 GPPL VDGIDKLDIEF Sbjct: 20 GPPLEVDGIDKLDIEF 35 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 65 LAVVLQRRDWENPGVTQL 82 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.5 bits (78), Expect = 0.029 Identities = 14/17 (82%), Positives = 17/17 (100%) Frame = +3 Query: 399 REFDIKLIDTVDLEGGP 449 +++DIKLIDTVDLEGGP Sbjct: 34 KKYDIKLIDTVDLEGGP 50 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 461 NWVPGPPLXVDGIDKLDIEF 402 +W G PL VDGIDKLDIEF Sbjct: 18 SWDRGAPLEVDGIDKLDIEF 37 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 67 LAVVLQRRDWENPGVTQL 84 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.5 bits (78), Expect = 0.029 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = +2 Query: 404 IRYQAYRYRRPXGGAPVXXXXXXXXXXXXLAVVLQGRDWENPGVPNL 544 ++ + + R GG P+ LAVVLQ RDWENPGV L Sbjct: 36 VKVKKFNQARVNGGDPLESTCRHASLA--LAVVLQRRDWENPGVTQL 80 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 35.1 bits (77), Expect = 0.038 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 548 RLSWERQGFPSHDLVKRRPV 489 RLSW GFPSHD+VKRRPV Sbjct: 51 RLSW---GFPSHDVVKRRPV 67 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 35.1 bits (77), Expect = 0.038 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = +2 Query: 434 PXGGAPVXXXXXXXXXXXXLAVVLQGRDWENPGVPNL 544 P GG P+ LAVVLQ RDWENPGV L Sbjct: 1046 PSGGDPLESTCRHASLA--LAVVLQRRDWENPGVTQL 1080 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 35.1 bits (77), Expect = 0.038 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 534 TPGFSQSRPCKTTASE 487 TPGFSQSR CKTTASE Sbjct: 563 TPGFSQSRRCKTTASE 578 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 35 LAVVLQRRDWENPGVTQL 52 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 62 LAVVLQRRDWENPGVTQL 79 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 44 LAVVLQRRDWENPGVTQL 61 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 36 LAVVLQRRDWENPGVTQL 53 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 62 LAVVLQRRDWENPGVTQL 79 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 67 LAVVLQRRDWENPGVTQL 84 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 38 LAVVLQRRDWENPGVTQL 55 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 58 LAVVLQRRDWENPGVTQL 75 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 70 LAVVLQRRDWENPGVTQL 87 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 46 LAVVLQRRDWENPGVTQL 63 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 35 LAVVLQRRDWENPGVTQL 52 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 25 LAVVLQRRDWENPGVTQL 42 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 50 LAVVLQRRDWENPGVTQL 67 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 59 LAVVLQRRDWENPGVTQL 76 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 53 LAVVLQRRDWENPGVTQL 70 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 69 LAVVLQRRDWENPGVTQL 86 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 57 LAVVLQRRDWENPGVTQL 74 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 40 LAVVLQRRDWENPGVTQL 57 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 216 LAVVLQRRDWENPGVTQL 233 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 449 GPPLXVDGIDKLD 411 GPPL VDGIDKLD Sbjct: 20 GPPLEVDGIDKLD 32 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 111 LAVVLQRRDWENPGVTQL 128 Score = 31.9 bits (69), Expect = 0.36 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = -1 Query: 449 GPPLXVDGIDKLDIEFAAAIYSVDIN-SYEILKYIVNTLFRY--*FSKIFFTSHREHQGK 279 GPPL VDGIDKLD A + V I ++L + + T R FS + T H G+ Sbjct: 20 GPPLEVDGIDKLD---AVTLALVQICWQVDVLGHFLRTANRIPDLFSTLEHTEAEVHWGE 76 Query: 278 G 276 G Sbjct: 77 G 77 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 49 LAVVLQRRDWENPGVTQL 66 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 28 LAVVLQRRDWENPGVTQL 45 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 16 LAVVLQRRDWENPGVTQL 33 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 47 LAVVLQRRDWENPGVTQL 64 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 381 LAVVLQRRDWENPGVTQL 398 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 107 LAVVLQRRDWENPGVTQL 124 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 83 LAVVLQRRDWENPGVTQL 100 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 39 LAVVLQRRDWENPGVTQL 56 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 8 LAVVLQRRDWENPGVTQL 25 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 18 LAVVLQRRDWENPGVTQL 35 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 38 LAVVLQRRDWENPGVTQL 55 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 103 LAVVLQRRDWENPGVTQL 120 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 45 LAVVLQRRDWENPGVTQL 62 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 340 LAVVLQRRDWENPGVTQL 357 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 80 LAVVLQRRDWENPGVTQL 97 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 50 LAVVLQRRDWENPGVTQL 67 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 16 LAVVLQRRDWENPGVTQL 33 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 59 LAVVLQRRDWENPGVTQL 76 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 43 LAVVLQRRDWENPGVTQL 60 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 134 LAVVLQRRDWENPGVTQL 151 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 63 LAVVLQRRDWENPGVTQL 80 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 39 LAVVLQRRDWENPGVTQL 56 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 143 LAVVLQRRDWENPGVTQL 160 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 833 LAVVLQRRDWENPGVTQL 850 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 16 LAVVLQRRDWENPGVTQL 33 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 60 LAVVLQRRDWENPGVTQL 77 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 34 LAVVLQRRDWENPGVTQL 51 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 73 LAVVLQRRDWENPGVTQL 90 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect = 0.050 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 448 GPPSRSTVSISLISNS 401 GPPSRSTVSISLISNS Sbjct: 22 GPPSRSTVSISLISNS 37 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 67 LAVVLQRRDWENPGVTQL 84 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 56 LAVVLQRRDWENPGVTQL 73 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 69 LAVVLQRRDWENPGVTQL 86 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 256 LAVVLQRRDWENPGVTQL 273 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 114 LAVVLQRRDWENPGVTQL 131 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 50 LAVVLQRRDWENPGVTQL 67 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 36 LAVVLQRRDWENPGVTQL 53 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 37 LAVVLQRRDWENPGVTQL 54 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 101 LAVVLQRRDWENPGVTQL 118 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 114 LAVVLQRRDWENPGVTQL 131 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 449 GPPLXVDGIDKLD 411 GPPL VDGIDKLD Sbjct: 20 GPPLEVDGIDKLD 32 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 39 LAVVLQRRDWENPGVTQL 56 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 20 LAVVLQRRDWENPGVTQL 37 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 58 LAVVLQRRDWENPGVTQL 75 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 37 LAVVLQRRDWENPGVTQL 54 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 34 LAVVLQRRDWENPGVTQL 51 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 11 LAVVLQRRDWENPGVTQL 28 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 19 LAVVLQRRDWENPGVTQL 36 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 396 LAVVLQRRDWENPGVTQL 413 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 45 LAVVLQRRDWENPGVTQL 62 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 54 LAVVLQRRDWENPGVTQL 71 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 36 LAVVLQRRDWENPGVTQL 53 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 29 LAVVLQRRDWENPGVTQL 46 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 119 LAVVLQRRDWENPGVTQL 136 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 55 LAVVLQRRDWENPGVTQL 72 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 34.7 bits (76), Expect = 0.050 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +2 Query: 491 LAVVLQGRDWENPGVPNL 544 LAVVLQ RDWENPGV L Sbjct: 68 LAVVLQRRDWENPGVTQL 85 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,070,580 Number of Sequences: 59808 Number of extensions: 364392 Number of successful extensions: 4646 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4641 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -