BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0969.Seq (571 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0490 - 10879761-10879861,10879946-10880185,10880274-108803... 28 6.0 08_02_0601 + 19177129-19177245,19178231-19179103 27 8.0 01_06_0873 + 32617428-32617532,32618166-32618234,32619195-326193... 27 8.0 >02_02_0490 - 10879761-10879861,10879946-10880185,10880274-10880337, 10880426-10880731,10881098-10881312,10881417-10881711, 10882193-10882357,10882477-10882527,10882657-10883109, 10883195-10883281,10883736-10884800,10884858-10885376 Length = 1186 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 203 VPIVCYPLWYQQYWRLVVRPLQ 138 VPI+ LWYQQY+ R LQ Sbjct: 770 VPIIAASLWYQQYYIDGARELQ 791 >08_02_0601 + 19177129-19177245,19178231-19179103 Length = 329 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +3 Query: 354 VLCWRTMASSGARTAGATNIHFIPRSSYIQVRWN 455 V CWR+ A G AG + + + S ++ W+ Sbjct: 23 VYCWRSTAVPGGTAAGEVKLDILIKQSKMEYIWS 56 >01_06_0873 + 32617428-32617532,32618166-32618234,32619195-32619380, 32619687-32619776,32620389-32620462,32621149-32621260, 32621413-32621468,32621826-32621880,32621965-32622021, 32622696-32622797,32623467-32623547,32623756-32623808, 32625245-32625314,32626540-32626603,32627339-32627487, 32627564-32627719,32628011-32628108,32628763-32628847, 32628932-32628997,32629066-32629125,32629408-32629494, 32630307-32630360,32630538-32630576,32630651-32630779, 32630859-32630911,32630984-32631032,32632240-32632298, 32633111-32633259,32633338-32633492,32633719-32633847, 32633932-32634017,32634220-32634335,32634429-32634541, 32635335-32635458,32635540-32635658,32636289-32636490, 32636586-32636757,32637852-32638176,32638442-32638529, 32638970-32639059,32639169-32639370,32639681-32639705 Length = 1450 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 192 LLSSVVSTVLEISRQTL-TSPNYKNE 118 L SS V +VL+I L TSPNYKN+ Sbjct: 1005 LESSYVKSVLDIYELVLQTSPNYKND 1030 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,121,562 Number of Sequences: 37544 Number of extensions: 310967 Number of successful extensions: 613 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 613 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -