BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0969.Seq (571 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX640705-1|CAE45825.1| 447|Homo sapiens hypothetical protein pr... 31 2.2 BC106938-1|AAI06939.1| 576|Homo sapiens zinc finger protein 791... 30 6.6 BC106937-1|AAI06938.1| 576|Homo sapiens zinc finger protein 791... 30 6.6 AK074877-1|BAC11261.1| 576|Homo sapiens essor-4. protein. 30 6.6 AK131281-1|BAD18456.1| 692|Homo sapiens protein ( Homo sapiens ... 29 8.7 >BX640705-1|CAE45825.1| 447|Homo sapiens hypothetical protein protein. Length = 447 Score = 31.5 bits (68), Expect = 2.2 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 367 RQHNTQNYFKWKHCKKT*IPPLWFLIPHLIHGGKKAGPTKCK 242 R H Q +++ K C KT + PL F H G K P +CK Sbjct: 246 RNHTAQKHYECKLCGKTYLSPLGFQAHESTHTGDK--PFECK 285 >BC106938-1|AAI06939.1| 576|Homo sapiens zinc finger protein 791 protein. Length = 576 Score = 29.9 bits (64), Expect = 6.6 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 361 HNTQNYFKWKHCKKT*IPPLWFLIPHLIHGGKKAGPTKCK 242 HN +K K C K I P + + IH G+K P KCK Sbjct: 266 HNGDRPYKCKECGKAFIFPSFLRVHERIHTGEK--PYKCK 303 >BC106937-1|AAI06938.1| 576|Homo sapiens zinc finger protein 791 protein. Length = 576 Score = 29.9 bits (64), Expect = 6.6 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 361 HNTQNYFKWKHCKKT*IPPLWFLIPHLIHGGKKAGPTKCK 242 HN +K K C K I P + + IH G+K P KCK Sbjct: 266 HNGDRPYKCKECGKAFIFPSFLRVHERIHTGEK--PYKCK 303 >AK074877-1|BAC11261.1| 576|Homo sapiens essor-4. protein. Length = 576 Score = 29.9 bits (64), Expect = 6.6 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 361 HNTQNYFKWKHCKKT*IPPLWFLIPHLIHGGKKAGPTKCK 242 HN +K K C K I P + + IH G+K P KCK Sbjct: 266 HNGDRPYKCKECGKAFIFPSFLRVHERIHTGEK--PYKCK 303 >AK131281-1|BAD18456.1| 692|Homo sapiens protein ( Homo sapiens cDNA FLJ16231 fis, clone FEBRA2027609, moderately similar to Zinc finger protein 91. ). Length = 692 Score = 29.5 bits (63), Expect = 8.7 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -1 Query: 394 VRAPLDAIVRQHNTQNYFKWKHCKKT*IPPLWFLIPHLIHGGKKAGPTKC 245 V++ L+ R H + +K C KT +F+ H +H G+K P KC Sbjct: 591 VKSNLEGHRRIHTGEKPYKCNECGKTFSRKSYFICHHRLHTGEK--PYKC 638 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,182,780 Number of Sequences: 237096 Number of extensions: 1837374 Number of successful extensions: 2665 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2665 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5816287018 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -