BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0968.Seq (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 1.0 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 1.8 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 3.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.1 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.8 bits (49), Expect = 1.0 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +2 Query: 380 FIDADNVERVKSHADMELILSRSSLRGTYCSRYVLP 487 ++ +NVE+ +H ++I R + + RYV P Sbjct: 758 YLQIENVEQTLNHEIKKVIPGRITQKSCSTKRYVTP 793 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 112 LMTAALCSTARNMDLSTLGGRFRLRS 35 L T S ++ D+S+ RFRLRS Sbjct: 40 LKTTQSVSVTKDQDVSSSVNRFRLRS 65 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 82 RNMDLSTLGGRFRLRSSMYNLINTFYS 2 +N D+ T + + M +INTFYS Sbjct: 6 QNGDVETFAFQAEIAQLMSLIINTFYS 32 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 113 ANDGCIVQYRPEHGPLDAW 57 A +G I Y+ +GP D W Sbjct: 1128 AANGVIKGYKVIYGPSDTW 1146 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,309 Number of Sequences: 336 Number of extensions: 2847 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -