BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0966.Seq (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 25 1.0 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 23 4.1 AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-tran... 23 4.1 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 25.0 bits (52), Expect = 1.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 324 CCXSHLGCQTSRRLVVARSLKLPKGHQGQE 235 C S LGC ++R A L P G G E Sbjct: 7 CAVSVLGCAYTQRTKCAACLDSPDGMNGNE 36 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 4.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 152 ATNSFLFYIFYKACNVTLFYNLYKV 78 A FLF Y+ +T FY LY++ Sbjct: 291 AAQVFLFVAAYETNAITTFYCLYEL 315 >AF513637-1|AAM53609.1| 214|Anopheles gambiae glutathione S-transferase D11 protein. Length = 214 Score = 23.0 bits (47), Expect = 4.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 119 CKKYRKGMSL*PFFPSKHLLVNE 187 C+KY K L P P K +VN+ Sbjct: 73 CEKYGKNDGLYPKDPKKRAVVNQ 95 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 362,997 Number of Sequences: 2352 Number of extensions: 6079 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -