BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0965.Seq (449 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 22 2.3 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 2.3 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 3.1 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 20 9.4 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 20 9.4 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.2 bits (45), Expect = 2.3 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = -1 Query: 386 ITGHSRFTGYSCWDDXNISIFDGCLIAPQVPCAADLGWGVHVGKSAATPGVTGAMS 219 +TG + G + + + S DG P ++ L +G V +PG G +S Sbjct: 44 LTGSTNGDGGARSNADSTSHTDGASTPDVRPPSSSLSYGGPVNDDVRSPGTPGPLS 99 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 2.3 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = -1 Query: 386 ITGHSRFTGYSCWDDXNISIFDGCLIAPQVPCAADLGWGVHVGKSAATPGVTGAMS 219 +TG + G + + + S DG P ++ L +G V +PG G +S Sbjct: 200 LTGSTNGDGGARSNADSTSHTDGASTPDVRPPSSSLSYGGPVNDDVRSPGTPGPLS 255 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.8 bits (44), Expect = 3.1 Identities = 9/20 (45%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +2 Query: 77 LYKMVQRTFPP-HHRGTLKW 133 LYK +++ FPP G L W Sbjct: 286 LYKKIKKAFPPLSLHGQLLW 305 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 264 MNTPAKVSGTRDLRSYQAAIK 326 M+ P ++GT+ + Q+AIK Sbjct: 265 MHHPVAMTGTKTVMPSQSAIK 285 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 Query: 77 LYKMVQRTFPPHHRGTLKWWS 139 L + + R H GTLK WS Sbjct: 79 LEQFIVRFMKYHFFGTLKLWS 99 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 47 NIFVVCLTCIYV 12 +IF VC T IY+ Sbjct: 163 HIFTVCRTLIYI 174 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,199 Number of Sequences: 336 Number of extensions: 2462 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -