BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0965.Seq (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 2.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 2.7 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 214 LYDIAPVTPGVAADFPT*TPQPRSAAQG 297 LYDIAP++ V P P P G Sbjct: 181 LYDIAPLSDFVIHRSPELVPMPTLKGDG 208 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 2.7 Identities = 15/57 (26%), Positives = 23/57 (40%) Frame = +3 Query: 159 RPAFGPSTEAESSGDQAGFIRHSACDPRRRSRLSHMNTPAKVSGTRDLRSYQAAIKD 329 RP F AE +++ FIR + R L H A+ +L + A+ D Sbjct: 120 RPVFSTLQRAEYPTNRSLFIREQTEEMYREMLLEHKKRRARRDIHPELNTQGIALAD 176 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,856 Number of Sequences: 438 Number of extensions: 3213 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -