BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0964.Seq (555 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 3.1 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 22 4.1 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +2 Query: 179 LYFMKYMSLDNLNIVEVFQLNLKNVGKKCYIYSNKYCKKLNF*YIRI 319 L+F+ Y+SL ++ G+K + +NKYC + Y+ + Sbjct: 290 LFFIVYVSL----LLGPHPTYFGKTGRKTVLKTNKYCNFIILFYLSV 332 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 503 CIFIHSRRINRCNFSQF 453 CI I S R N NFS+F Sbjct: 6 CIPISSGRTNGSNFSKF 22 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,637 Number of Sequences: 336 Number of extensions: 1733 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13725787 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -