BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0910.Seq (369 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0005 - 16886553-16886946,16887079-16887404 28 2.6 05_03_0451 - 14181990-14182221,14182522-14182621,14182814-14182892 27 6.1 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 27.9 bits (59), Expect = 2.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 148 RNNFSIRYWSWNYRGC 101 R+N S RYW W GC Sbjct: 90 RSNSSFRYWRWQPHGC 105 >05_03_0451 - 14181990-14182221,14182522-14182621,14182814-14182892 Length = 136 Score = 26.6 bits (56), Expect = 6.1 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 198 IRGDTDTFAEHIVXEAGVLKTPVQYQN--PIAVLFG 299 + G + A H+V EA +L P+Q P+A L G Sbjct: 101 VNGGISSMAAHVVKEAAMLTVPMQGMGSCPVAFLSG 136 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,426,768 Number of Sequences: 37544 Number of extensions: 136913 Number of successful extensions: 293 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 293 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 576724416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -