BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0907.Seq (419 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 2.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 4.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 4.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 4.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 4.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 4.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 4.9 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 4.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 4.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 20 8.5 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 20 8.5 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 2.1 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -2 Query: 259 RQHLKDASPVLDHAICKSYPDSSKLTTSDARP 164 R+H+K A PV+ + C S++L P Sbjct: 67 RRHIKGAIPVVSLSTCSMLCGSTQLWPQPTGP 98 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 226 QVPATHLSNVALSTFDGSFCDYHGCTGNXGI 318 ++ +THL + T + C Y T + G+ Sbjct: 80 RLASTHLQSPNTQTHPSASCKYADSTSSTGV 110 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 226 QVPATHLSNVALSTFDGSFCDYHGCTGNXGI 318 ++ +THL + T + C Y T + G+ Sbjct: 80 RLASTHLQSPNTQTHPSASCKYADSTSSTGV 110 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 226 QVPATHLSNVALSTFDGSFCDYHGCTGNXGI 318 ++ +THL + T + C Y T + G+ Sbjct: 80 RLASTHLQSPNTQTHPSASCKYADSTSSTGV 110 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 226 QVPATHLSNVALSTFDGSFCDYHGCTGNXGI 318 ++ +THL + T + C Y T + G+ Sbjct: 80 RLASTHLQSPNTQTHPSASCKYADSTSSTGV 110 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 226 QVPATHLSNVALSTFDGSFCDYHGCTGNXGI 318 ++ +THL + T + C Y T + G+ Sbjct: 80 RLASTHLQSPNTQTHPSASCKYADSTSSTGV 110 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 226 QVPATHLSNVALSTFDGSFCDYHGCTGNXGI 318 ++ +THL + T + C Y T + G+ Sbjct: 36 RLASTHLQSPNTQTHPSASCKYADSTSSTGV 66 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 226 QVPATHLSNVALSTFDGSFCDYHGCTGNXGI 318 ++ +THL + T + C Y T + G+ Sbjct: 80 RLASTHLQSPNTQTHPSASCKYADSTSSTGV 110 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 4.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +1 Query: 226 QVPATHLSNVALSTFDGSFCDYHGCTGNXGI 318 ++ +THL + T + C Y T + G+ Sbjct: 80 RLASTHLQSPNTQTHPSASCKYADSTSSTGV 110 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.2 bits (40), Expect = 8.5 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = +2 Query: 41 WFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDG 163 WF + T IT ++H ++ T+ M + DG Sbjct: 1146 WFDENTKDTKITAASETILHGLKKYTNYSMEVLAYTSGGDG 1186 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 20.2 bits (40), Expect = 8.5 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +1 Query: 238 THLSNVALSTFDGSFCDYHGCTGNXGI 318 THL + T + C Y T + G+ Sbjct: 84 THLQSPNTQTHPSASCKYADSTSSTGV 110 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,541 Number of Sequences: 336 Number of extensions: 1650 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9279512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -